Gene Information

Name : yceE (BSU02910)
Accession : NP_388173.1
Strain : Bacillus subtilis 168
Genome accession: NC_000964
Putative virulence/resistance : Resistance
Product : hypothetical protein
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG2310
EC number : -
Position : 313396 - 313974 bp
Length : 579 bp
Strand : +
Note : Evidence 3: Function proposed based on presence of conserved amino acid motif, structural feature or limited homology; Product type pf: factor

DNA sequence :
ATGGCCATTCAATTATCAAAAGGACAGCGCATTGATTTAACAAAAACAAATCCGGGACTGACTAAAGCGGTGATCGGCTT
AGGCTGGGATACAAACAAGTACTCCGGCGGACACGATTTTGACCTGGATGCTTCGGCCTTTTTAGTTGATGCGCATGATA
ACTGCGTAAATGATCTCGATTTCGTCTTCTATAATAACCTTGAACATCCGAGCGGCGGTGTCATCCATACGGGTGACAAC
CGCACGGGTGAGGGCGACGGAGATGATGAGCAGATTATCGTTGATTTCTCAAAAATCCCTGCTCACATTGAGAAAATCGG
CATCACAGTGACCATTCACGACGCTGAAGCACGCAGCCAAAACTTTGGACAAGTTTCCAATGCATTTGTCCGCGTTGTGG
ATGAAGAAACGCAGAATGAGCTTCTTCGCTTCGATTTGGGAGAAGACTTCTCCATTGAAACAGCTGTTGTCGTTTGTGAG
CTTTACAGACACGGCGGCGAGTGGAAATTCAATGCAATCGGCAGCGGATTTTCCGGCGGGCTGGCTGCATTGTGCCGGAA
TTACGGTTTGCAAGTGTAA

Protein sequence :
MAIQLSKGQRIDLTKTNPGLTKAVIGLGWDTNKYSGGHDFDLDASAFLVDAHDNCVNDLDFVFYNNLEHPSGGVIHTGDN
RTGEGDGDDEQIIVDFSKIPAHIEKIGITVTIHDAEARSQNFGQVSNAFVRVVDEETQNELLRFDLGEDFSIETAVVVCE
LYRHGGEWKFNAIGSGFSGGLAALCRNYGLQV

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
unnamed ACY75542.1 tellurium-resistance protein Not tested Tn6060 Protein 2e-53 57
terE_2 NP_287119.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 4e-47 54
tlrB AAF36434.1 putative tellurium resistance protein B Not tested TAI Protein 3e-47 54
terE NP_286711.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 4e-47 54
terD NP_286710.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 7e-52 53
terD_2 NP_287118.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 7e-52 53
tlrC AAF36435.1 putative tellurium resistance protein C Not tested TAI Protein 1e-51 53
unnamed ACY75541.1 tellurium-resistance protein Not tested Tn6060 Protein 8e-45 50
terZ ACY75546.1 tellurite resistance protein TerZ Not tested Tn6060 Protein 6e-27 42

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
yceE NP_388173.1 hypothetical protein BAC0390 Protein 2e-51 55
yceE NP_388173.1 hypothetical protein BAC0389 Protein 5e-52 54