Gene Information

Name : terE_2 (Z1615)
Accession : NP_287119.1
Strain : Escherichia coli EDL933
Genome accession: NC_002655
Putative virulence/resistance : Resistance
Product : phage inhibition, colicin resistance and tellurite resistance protein
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG2310
EC number : -
Position : 1500245 - 1500820 bp
Length : 576 bp
Strand : +
Note : -

DNA sequence :
ATGGCAGTTTCTCTCGTAAAAGGCGGCAACGTATCTCTGACCAAAGAAGCACCAACCATGAATGTCGCTATGGTTGGCCT
GGGCTGGGATGCCCGTGTAACCGATGGTCAGGGTTTTGATCTGGACGCTTCCGTATTCGCAGTAGGTGAAGACGGTAAAG
TACTGTCAGATGCCCATTTCATTTTCTTCAATAATAAAACCAGCCCTGATGGCGCAGTAGAGCACCAGGGCGACAACCGT
ACCGGTGAAGGCGACGGCGACGATGAGCAGGTCAAAATCGATCTGACCAAAGTCTCAGCAGACATCAAAAAACTGGTATT
TGCCGTTACCATCTATGATGCAGAAGCGCGTAAACAAAACTTCGGCATGGTGAGCAACAGCTTCATGCGCGTTTACAACA
ACGACAACGGGACGGAAATTGCCCGTTTCGATCTGTCTGAAGACGCCTCAACCGAAACCGCAATGGTCTTCGGTGAACTG
TATCGCCATGGTACTGAGTGGAAGTTTAAAGCTGTTGGCCAGGGTTTTGCCGGTGGTCTGTCAGCGCTTGCTTCCCAGCA
CGGCGTCAATGTCTAA

Protein sequence :
MAVSLVKGGNVSLTKEAPTMNVAMVGLGWDARVTDGQGFDLDASVFAVGEDGKVLSDAHFIFFNNKTSPDGAVEHQGDNR
TGEGDGDDEQVKIDLTKVSADIKKLVFAVTIYDAEARKQNFGMVSNSFMRVYNNDNGTEIARFDLSEDASTETAMVFGEL
YRHGTEWKFKAVGQGFAGGLSALASQHGVNV

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
terE_2 NP_287119.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 1e-83 100
tlrB AAF36434.1 putative tellurium resistance protein B Not tested TAI Protein 8e-84 100
terE NP_286711.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 1e-83 100
unnamed ACY75541.1 tellurium-resistance protein Not tested Tn6060 Protein 7e-65 72
tlrC AAF36435.1 putative tellurium resistance protein C Not tested TAI Protein 4e-59 65
terD NP_286710.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 2e-59 65
terD_2 NP_287118.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 2e-59 65
unnamed ACY75542.1 tellurium-resistance protein Not tested Tn6060 Protein 1e-58 64

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
terE_2 NP_287119.1 phage inhibition, colicin resistance and tellurite resistance protein BAC0390 Protein 1e-78 87
terE_2 NP_287119.1 phage inhibition, colicin resistance and tellurite resistance protein BAC0389 Protein 2e-58 65