Gene Information

Name : rpmF (L00096)
Accession : NP_266250.1
Strain : Lactococcus lactis IL1403
Genome accession: NC_002662
Putative virulence/resistance : Unknown
Product : 50S ribosomal protein L32
Function : -
COG functional category : J : Translation, ribosomal structure and biogenesis
COG ID : COG0333
EC number : -
Position : 96058 - 96231 bp
Length : 174 bp
Strand : -
Note : some L32 proteins have zinc finger motifs consisting of CXXC while others do not

DNA sequence :
ATGGCAGTACCTGCACGTCACACTTCATCAGCAAAGAAAAACCGTCGTCGTACACATTACAAATTGACAGCTCCAACTGT
TACTTTTGACGAAACTACTGGTGACTACCGTCACTCACATCGCGTTTCACTTAAAGGCTACTACAAAGGCCGCAAAGTTC
GCGACACTAAATAA

Protein sequence :
MAVPARHTSSAKKNRRRTHYKLTAPTVTFDETTGDYRHSHRVSLKGYYKGRKVRDTK

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
rpmF NP_814315.1 50S ribosomal protein L32 Not tested Not named Protein 1e-12 67
ef0071 AAM75276.1 EF0071 Not tested Not named Protein 9e-13 67
ef0104 AAM75307.1 EF0104 Not tested Not named Protein 9e-12 67
rpmF NP_814351.1 50S ribosomal protein L32 Not tested Not named Protein 1e-11 67