Gene Information

Name : mll2167 (mll2167)
Accession : NP_103577.1
Strain : Mesorhizobium loti MAFF303099
Genome accession: NC_002678
Putative virulence/resistance : Resistance
Product : arsenate reductase
Function : -
COG functional category : P : Inorganic ion transport and metabolism
COG ID : COG1393
EC number : -
Position : 1759565 - 1759987 bp
Length : 423 bp
Strand : -
Note : -

DNA sequence :
ATGACCATCACCATCTATCACAACCCCGATTGCGGCACGTCGCGCAACACGCTGGCGATCATCCGCCAATCCGGCGAGGA
GCCGCAGGTGATCGAATATCTGAAGACGCCGCCGTCGCGCGCCAGGCTCGTCGAATTGCTCGAGGCGATGGCGATGACGC
CGCGCCAATTGCTGCGCGAGAAGGGCACGCCCTATGCGGAGCTCGGCCTTGGCGATCCCAAATGGAGCGACGACGAGATC
CTCGATTTCATGCTGGCGCATCCGATCCTGATCAACCGGCCGATCGTGGTAACGCCGCTCGGCGTCGTGCTGGCCCGGCC
GTCCGAAGCGGTGCTCGATATCCTGCCCAATCCCGACATCGGCCCGTTCACCAAGGAGGACGGCGAAGTCGTCGTCGACG
CAAGCGGCAAGCGGGTCGTCTGA

Protein sequence :
MTITIYHNPDCGTSRNTLAIIRQSGEEPQVIEYLKTPPSRARLVELLEAMAMTPRQLLREKGTPYAELGLGDPKWSDDEI
LDFMLAHPILINRPIVVTPLGVVLARPSEAVLDILPNPDIGPFTKEDGEVVVDASGKRVV

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
arsC2 YP_001007634.1 arsenate reductase Not tested YAPI Protein 1e-40 64
arsC ADZ05768.1 arsenate reductase Not tested AbaR11 Protein 3e-39 56
arsR CAJ77019.1 arsenate reductase Not tested AbaR1 Protein 2e-39 56
arsC AFC76436.1 ArsC Not tested AbaR5 Protein 3e-39 56

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
mll2167 NP_103577.1 arsenate reductase BAC0583 Protein 2e-42 66
mll2167 NP_103577.1 arsenate reductase BAC0584 Protein 1e-43 65
mll2167 NP_103577.1 arsenate reductase BAC0585 Protein 5e-42 64
mll2167 NP_103577.1 arsenate reductase BAC0582 Protein 2e-42 64