Gene Information

Name : ECs1407 (ECs1407)
Accession : NP_309434.1
Strain : Escherichia coli Sakai
Genome accession: NC_002695
Putative virulence/resistance : Virulence
Product : hypothetical protein
Function : -
COG functional category : -
COG ID : -
EC number : -
Position : 1454928 - 1455419 bp
Length : 492 bp
Strand : +
Note : similar to hypothetical protein L0008 [Escherichia coli] gi|3414876|gb|AAC31487.1, YeeW [Escherichia coli] gi|3025160|sp|P76366|YEEW_ECOLI

DNA sequence :
ATGATGAAACTGGCCCTGACACTGGAAGCCGACAGCGTTAACGTACAGGCACTGAACATGGGGCGCATTGTCGTTGACGT
CGATGGTATTGAGCTCGCTGAACTGATTAACATGGTCTGCGATAACGGCTACTCCCTTCGTGTTGTTGATGAATCTGACC
AGACCTCAGCAGAATGCACGCCACCATTTGCTACCCTTACCGGCATACGCTGCAGTACCGCACATATCACGGAAACGGAC
AACGCCTGGCTGTACTCGCTGTCACACCAGACCAGTGACTTCGGTGAATCAGAATGGATTCATTTTACCGGTAACGGCTA
TCTGTTGCGTACCGATGCGTGGTCGTACCCGGTTCTGCGGCTTAAACGCCTGGGTCTGTCAAAAACGTTCCGTCGTCTGG
TCGTCACACTCATCCGGCGTTATGGCGTCAGTCTCATTCATCTGGATGCCAGCGCTGAATGCCTGCCGGGTTTACCCACT
TTCGACTGGTAA

Protein sequence :
MMKLALTLEADSVNVQALNMGRIVVDVDGIELAELINMVCDNGYSLRVVDESDQTSAECTPPFATLTGIRCSTAHITETD
NAWLYSLSHQTSDFGESEWIHFTGNGYLLRTDAWSYPVLRLKRLGLSKTFRRLVVTLIRRYGVSLIHLDASAECLPGLPT
FDW

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
Z1223 NP_286758.1 hypothetical protein Not tested TAI Protein 4e-72 100
Z1662 NP_287164.1 hypothetical protein Not tested TAI Protein 4e-72 100
unnamed AAL08479.1 unknown Not tested SRL Protein 4e-71 99
unnamed AAC31487.1 L0008 Not tested LEE Protein 8e-71 95
Z5092 NP_290243.1 hypothetical protein Not tested LEE Protein 1e-70 95
unnamed ACU09434.1 conserved hypothetical protein Not tested LEE Protein 8e-71 95
ECs4540 NP_312567.1 hypothetical protein Not tested LEE Protein 1e-70 95
unnamed CAD42102.1 hypothetical protein Not tested PAI II 536 Protein 1e-66 93
unnamed CAI43904.1 hypothetical protein Not tested LEE Protein 4e-66 91
unnamed AAL57574.1 unknown Not tested LEE Protein 4e-59 90
yeeW CAE85205.1 YeeW protein Not tested PAI V 536 Protein 3e-65 90
c5148 NP_756996.1 hypothetical protein Not tested PAI II CFT073 Protein 6e-65 89
yeeW ADD91698.1 YeeW Not tested PAI-I AL862 Protein 2e-64 89
z5092 CAD33790.1 Z5092 protein Not tested PAI I 536 Protein 3e-64 88
unnamed CAD66208.1 hypothetical protein Not tested PAI III 536 Protein 2e-65 88
yeeW CAI43849.1 YeeW protein Not tested LEE Protein 3e-64 87
aec77 AAW51760.1 Aec77 Not tested AGI-3 Protein 1e-61 86
yeeW NP_708774.1 hypothetical protein Not tested SHI-1 Protein 3e-62 86
yeeW AAZ04462.1 conserved hypothetical protein Not tested PAI I APEC-O1 Protein 4e-61 86
APECO1_3485 YP_854326.1 hypothetical protein Not tested PAI I APEC-O1 Protein 5e-61 86
yeeW NP_838488.1 hypothetical protein Not tested SHI-1 Protein 3e-62 86
ECO103_3593 YP_003223450.1 hypothetical protein Not tested LEE Protein 2e-62 85
unnamed AAK00483.1 unknown Not tested SHI-1 Protein 2e-55 84
unnamed AAL67388.1 L0008-like protein Not tested PAI II CFT073 Protein 9e-54 82

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
ECs1407 NP_309434.1 hypothetical protein VFG1070 Protein 2e-71 99
ECs1407 NP_309434.1 hypothetical protein VFG0787 Protein 3e-71 95
ECs1407 NP_309434.1 hypothetical protein VFG1621 Protein 6e-67 93
ECs1407 NP_309434.1 hypothetical protein VFG1531 Protein 1e-64 88
ECs1407 NP_309434.1 hypothetical protein VFG1683 Protein 6e-66 88
ECs1407 NP_309434.1 hypothetical protein VFG0664 Protein 8e-63 86