Name : ECs3493 (ECs3493) Accession : NP_311520.1 Strain : Escherichia coli Sakai Genome accession: NC_002695 Putative virulence/resistance : Unknown Product : hypothetical protein Function : - COG functional category : L : Replication, recombination and repair COG ID : COG3436 EC number : - Position : 3482457 - 3482804 bp Length : 348 bp Strand : - Note : similar to hypothetical protein L0014 [Escherichia coli O157:H7 strain EDL933] gi|3288157|emb|CAA11510.1|, similar tohypothetical proteins e.g. ORF50 [Escherichia coli] gi|6009426|dbj|BAA84885.1| DNA sequence : ATGATCCCGTTACCTTCCGGGACCAAAATTTGGCTGGTTGCCGGTATCACCGATATGAGAAATGGCTTCAACGGCCTGGC TGCGAAAGTACAAACGGCGCTGAAAGACGATCCCATGTCCGGCCATGTTTTCATTTTCCGGGGCCGCAGCGGCAGTCAGG TTAAACTGCTGTGGTCCACCGGTGACGGACTGTGCCTCCTGACCAAACGGCTGGAGCGTGGGCGCTTCGCCTGGCCGTCA GCCCGTGATGGCAAAGTGTTCCTTACGCAGGCGCAGCTGGCGATGCTGCTGGAAGGTATCGACTGGCGACAGCCTAAGCG GCTGCTGACCTCCCTGACCATGCTGTAA Protein sequence : MIPLPSGTKIWLVAGITDMRNGFNGLAAKVQTALKDDPMSGHVFIFRGRSGSQVKLLWSTGDGLCLLTKRLERGRFAWPS ARDGKVFLTQAQLAMLLEGIDWRQPKRLLTSLTML |
Gene | GenBank Accn | Product | Virulance or Resistance | PAI or REI | Alignment Type | E-val | Identity |
unnamed | AAL99258.1 | unknown | Not tested | LEE | Protein | 3e-49 | 100 |
ECs4546 | NP_312573.1 | hypothetical protein | Not tested | LEE | Protein | 4e-49 | 100 |
unnamed | ACU09438.1 | IS66 family element orf2 | Not tested | LEE | Protein | 3e-49 | 100 |
c3578 | NP_755453.1 | hypothetical protein | Not tested | PAI I CFT073 | Protein | 4e-49 | 100 |
unnamed | AAC31493.1 | L0014 | Not tested | LEE | Protein | 3e-49 | 100 |
Z4336 | NP_289561.1 | hypothetical protein | Not tested | OI-122 | Protein | 4e-49 | 100 |
hp4 | AAC61716.1 | Hp4 | Not tested | PAI I CFT073 | Protein | 3e-49 | 100 |
Z5097 | NP_290248.1 | prophage-associated protein | Not tested | LEE | Protein | 4e-49 | 100 |
l0014 | CAD33776.1 | L0014 protein | Not tested | PAI I 536 | Protein | 3e-36 | 99 |
Z1132 | NP_286667.1 | hypothetical protein | Not tested | TAI | Protein | 3e-48 | 99 |
Z1571 | NP_287075.1 | hypothetical protein | Not tested | TAI | Protein | 3e-48 | 99 |
unnamed | AAL08461.1 | unknown | Not tested | SRL | Protein | 6e-49 | 99 |
c3561 | NP_755436.1 | hypothetical protein | Not tested | PAI I CFT073 | Protein | 2e-48 | 98 |
ECUMN_3327 | YP_002414007.1 | putative transposase ORF2, IS66 family | Not tested | Not named | Protein | 2e-48 | 98 |
aec52 | AAW51735.1 | Aec52 | Not tested | AGI-3 | Protein | 3e-39 | 76 |
unnamed | ADD91739.1 | hypothetical protein | Not tested | PAI-I AL862 | Protein | 3e-39 | 76 |
pB171ORF50 | CAD66190.1 | ORF50 protein of pB171 | Not tested | PAI III 536 | Protein | 7e-39 | 75 |
Z4316 | NP_289542.1 | hypothetical protein | Not tested | OI-122 | Protein | 8e-37 | 72 |
ECO103_3553 | YP_003223420.1 | hypothetical protein | Not tested | LEE | Protein | 8e-37 | 72 |
BCAM0247 | YP_002232879.1 | putative transposase | Not tested | BcenGI11 | Protein | 3e-29 | 68 |
ECO103_3567 | YP_003223430.1 | hypothetical protein | Not tested | LEE | Protein | 2e-34 | 66 |
Z4338 | NP_289563.1 | hypothetical protein | Not tested | OI-122 | Protein | 2e-34 | 66 |
Z1160 | NP_286695.1 | hypothetical protein | Not tested | TAI | Protein | 4e-35 | 65 |
Z1599 | NP_287103.1 | hypothetical protein | Not tested | TAI | Protein | 4e-35 | 65 |
ECUMN_3364 | YP_002414037.1 | putative transposase ORF2, IS66 family | Not tested | Not named | Protein | 5e-35 | 64 |
Gene | GenBank Accn | Product | ID of source DB | Alignment Type | E-val | Identity |
ECs3493 | NP_311520.1 | hypothetical protein | VFG1709 | Protein | 1e-49 | 100 |
ECs3493 | NP_311520.1 | hypothetical protein | VFG0792 | Protein | 1e-49 | 100 |
ECs3493 | NP_311520.1 | hypothetical protein | VFG1517 | Protein | 1e-36 | 99 |
ECs3493 | NP_311520.1 | hypothetical protein | VFG1052 | Protein | 3e-49 | 99 |
ECs3493 | NP_311520.1 | hypothetical protein | VFG1698 | Protein | 6e-49 | 98 |
ECs3493 | NP_311520.1 | hypothetical protein | VFG1665 | Protein | 3e-39 | 75 |
ECs3493 | NP_311520.1 | hypothetical protein | VFG1737 | Protein | 1e-35 | 64 |