Gene Information

Name : ECs3865 (ECs3865)
Accession : NP_311892.1
Strain : Escherichia coli Sakai
Genome accession: NC_002695
Putative virulence/resistance : Unknown
Product : hypothetical protein
Function : -
COG functional category : L : Replication, recombination and repair
COG ID : COG3436
EC number : -
Position : 3870779 - 3871126 bp
Length : 348 bp
Strand : +
Note : similar to hypothetical proteins e.g. L0014 [Escherichia coli O157:H7 strain EDL933] gi|3414882|gb|AAC31493.1|

DNA sequence :
ATGATCCCGTTACCTTCCGGGACCAAAATTTGGCTGGTTGCCGGTATCACCGATATGAGAAATGGCTTCAACGGCCTGGC
TGCGAAAGTACAAACGGCGCTGAAAGACGATCCCATGTCCGGCCATGTTTTCATTTTCCGGGGCCGCAGCGGCAGTCAGG
TTAAACTGCTGTGGTCCACCGGTGACGGACTGTGCCTCCTGACCAAACGGCTGGAGCGTGGGCGCTTCGCCTGGCCGTCA
GCCCGTTATGGCAAAGTGTTCCTTACGCAGGCGCAGCTGGCGATGCTGCTGGAAGGTATCGACTGGCGACAGCCTAAGCG
GCTGCTGACCTCCCTGACCATGCTGTAA

Protein sequence :
MIPLPSGTKIWLVAGITDMRNGFNGLAAKVQTALKDDPMSGHVFIFRGRSGSQVKLLWSTGDGLCLLTKRLERGRFAWPS
ARYGKVFLTQAQLAMLLEGIDWRQPKRLLTSLTML

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
Z1132 NP_286667.1 hypothetical protein Not tested TAI Protein 2e-47 99
unnamed ACU09438.1 IS66 family element orf2 Not tested LEE Protein 3e-48 99
Z1571 NP_287075.1 hypothetical protein Not tested TAI Protein 2e-47 99
c3578 NP_755453.1 hypothetical protein Not tested PAI I CFT073 Protein 4e-48 99
unnamed AAC31493.1 L0014 Not tested LEE Protein 3e-48 99
Z4336 NP_289561.1 hypothetical protein Not tested OI-122 Protein 4e-48 99
hp4 AAC61716.1 Hp4 Not tested PAI I CFT073 Protein 3e-48 99
Z5097 NP_290248.1 prophage-associated protein Not tested LEE Protein 4e-48 99
ECs4546 NP_312573.1 hypothetical protein Not tested LEE Protein 4e-48 99
unnamed AAL99258.1 unknown Not tested LEE Protein 3e-48 99
l0014 CAD33776.1 L0014 protein Not tested PAI I 536 Protein 2e-35 98
unnamed AAL08461.1 unknown Not tested SRL Protein 5e-48 98
c3561 NP_755436.1 hypothetical protein Not tested PAI I CFT073 Protein 1e-47 97
ECUMN_3327 YP_002414007.1 putative transposase ORF2, IS66 family Not tested Not named Protein 1e-47 97
aec52 AAW51735.1 Aec52 Not tested AGI-3 Protein 2e-38 75
unnamed ADD91739.1 hypothetical protein Not tested PAI-I AL862 Protein 2e-38 75
pB171ORF50 CAD66190.1 ORF50 protein of pB171 Not tested PAI III 536 Protein 6e-38 74
ECO103_3553 YP_003223420.1 hypothetical protein Not tested LEE Protein 5e-36 72
Z4316 NP_289542.1 hypothetical protein Not tested OI-122 Protein 5e-36 72
BCAM0247 YP_002232879.1 putative transposase Not tested BcenGI11 Protein 8e-29 68
ECO103_3567 YP_003223430.1 hypothetical protein Not tested LEE Protein 1e-33 65
Z4338 NP_289563.1 hypothetical protein Not tested OI-122 Protein 1e-33 65
Z1160 NP_286695.1 hypothetical protein Not tested TAI Protein 3e-34 64
Z1599 NP_287103.1 hypothetical protein Not tested TAI Protein 3e-34 64
ECUMN_3364 YP_002414037.1 putative transposase ORF2, IS66 family Not tested Not named Protein 4e-34 63

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
ECs3865 NP_311892.1 hypothetical protein VFG1709 Protein 1e-48 99
ECs3865 NP_311892.1 hypothetical protein VFG0792 Protein 1e-48 99
ECs3865 NP_311892.1 hypothetical protein VFG1052 Protein 2e-48 98
ECs3865 NP_311892.1 hypothetical protein VFG1517 Protein 9e-36 98
ECs3865 NP_311892.1 hypothetical protein VFG1698 Protein 4e-48 97
ECs3865 NP_311892.1 hypothetical protein VFG1665 Protein 2e-38 74
ECs3865 NP_311892.1 hypothetical protein VFG1737 Protein 1e-34 63