Gene Information

Name : ECs4551 (ECs4551)
Accession : NP_312578.1
Strain : Escherichia coli Sakai
Genome accession: NC_002695
Putative virulence/resistance : Virulence
Product : hypothetical protein
Function : -
COG functional category : -
COG ID : -
EC number : -
Position : 4590088 - 4590366 bp
Length : 279 bp
Strand : -
Note : similar to L0017 [Escherichia coli EDL933] gi|3414885|gb|AAC31496.1|, hypothetical protein [Escherichia coli] gi|2809428|gb|AAC28566.1|

DNA sequence :
ATGGTTAATGATATTTCTGCTAATAAGATACTGGTGTGGGCGGCTGTAGCTGCGGCAAACCATAAGCTTCCCAAATATGC
GGAAGCTATCCTGAATGTATTCCCACAAATTATACCTGATAAAAAAGATATCGCACATTTAGAATTTATTATCTTATTTG
GATTAAATAGAAAAAATGATGCGGTAAAGGCTTTGGAGGACTGTATGGATGATGAGACGAGTCAGTTATTGTACAGTTTG
GTCCATGAGAATGGTAGTGGCTGGGTACGAGGATTTTAA

Protein sequence :
MVNDISANKILVWAAVAAANHKLPKYAEAILNVFPQIIPDKKDIAHLEFIILFGLNRKNDAVKALEDCMDDETSQLLYSL
VHENGSGWVRGF

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
Z5102 NP_290251.1 hypothetical protein Not tested LEE Protein 9e-38 100
ECs4551 NP_312578.1 hypothetical protein Not tested LEE Protein 9e-38 100
unnamed AAC31496.1 L0017 Not tested LEE Protein 6e-38 100
unnamed ACU09441.1 type III secretion system protein SsaH family Virulence LEE Protein 6e-38 100
ECO111_3735 YP_003236071.1 T3SS component Virulence LEE Protein 1e-37 98
unnamed AAC28566.1 unknown protein Not tested LEE Protein 1e-37 98
unnamed AAC38399.1 Orf29 Not tested LEE Protein 6e-36 95
unnamed AAK26732.1 unknown Not tested LEE Protein 1e-30 87
ECO26_5288 YP_003232170.1 T3SS component Virulence LEE Protein 2e-30 87
unnamed AAL57559.1 unknown Not tested LEE Protein 1e-30 87
st41 CAC81879.1 ST41 protein Not tested LEE II Protein 1e-30 87
unnamed CAI43857.1 hypothetical protein Not tested LEE Protein 1e-30 87
ECO103_3601 YP_003223458.1 T3SS component Virulence LEE Protein 2e-30 87
unnamed AAL06386.1 unknown Not tested LEE Protein 1e-27 86
unnamed AAL60255.1 unknown Not tested LEE Protein 7e-28 84
SESS1296_03617 AFO66342.1 putative LEE-encoded putative type III secretion system factor Not tested SESS LEE Protein 8e-17 55
SESS1635_03834 AFO66384.1 putative LEE-encoded putative type III secretion system factor Virulence SESS LEE Protein 8e-17 55

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
ECs4551 NP_312578.1 hypothetical protein VFG0795 Protein 3e-38 100
ECs4551 NP_312578.1 hypothetical protein VFG0747 Protein 2e-36 95