Gene Information

Name : ECs4587 (ECs4587)
Accession : NP_312614.1
Strain : Escherichia coli Sakai
Genome accession: NC_002695
Putative virulence/resistance : Virulence
Product : hypothetical protein
Function : -
COG functional category : -
COG ID : -
EC number : -
Position : 4619553 - 4619771 bp
Length : 219 bp
Strand : -
Note : similar to Orf2 [Escherichia coli strain E2348/69] gi|2865272|gb|AAC38365.1|, L0053 [Escherichia coli O157:H7 strain EDL933] gi|3414921|gb|AAC31532.1|

DNA sequence :
ATGATAACGATAACTGAGCTGGAAGATGAAATAATAAAAAATAAAGAAGCCGCAAATGTTTTTATTGAAAAAATAAACGA
CAAAAAGAACGAAATCCATGAAAAAATGAAACACCCTTTGGATAAAGTTACCTACGATGAAGCAAAGGAACTGCTCATTG
CGTGTGATGCGGCAATTAGGACTATAGAGATAATGCGAATCAGGATTAATAATAAATAG

Protein sequence :
MITITELEDEIIKNKEAANVFIEKINDKKNEIHEKMKHPLDKVTYDEAKELLIACDAAIRTIEIMRIRINNK

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
ECs4587 NP_312614.1 hypothetical protein Not tested LEE Protein 1e-26 100
ECO111_3771 YP_003236107.1 T3SS component Virulence LEE Protein 2e-26 99
Z5139 NP_290287.1 hypothetical protein Not tested LEE Protein 2e-26 99
unnamed AAC38365.1 Orf2 Not tested LEE Protein 1e-26 99
unnamed AAC31532.1 L0053 Not tested LEE Protein 1e-26 99
unnamed ACU09477.1 type III secretion system protein YseE family Virulence LEE Protein 1e-26 99
unnamed AAK26697.1 unknown Not tested LEE Protein 6e-25 95
unnamed AAL57524.1 unknown Not tested LEE Protein 6e-25 95
ECO103_3637 YP_003223494.1 T3SS component Virulence LEE Protein 9e-25 95
unnamed AAL57585.1 unknown Not tested LEE Protein 6e-25 95
ECO26_5252 YP_003232134.1 T3SS component Virulence LEE Protein 9e-25 95
st06 CAC81844.1 ST06 protein Not tested LEE II Protein 6e-25 95
unnamed CAI43892.1 hypothetical protein Not tested LEE Protein 6e-25 95
unnamed AAL06350.1 unknown Not tested LEE Protein 2e-22 88

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
ECs4587 NP_312614.1 hypothetical protein VFG0711 Protein 5e-27 99
ECs4587 NP_312614.1 hypothetical protein VFG0831 Protein 5e-27 99