Name : ECs4587 (ECs4587) Accession : NP_312614.1 Strain : Escherichia coli Sakai Genome accession: NC_002695 Putative virulence/resistance : Virulence Product : hypothetical protein Function : - COG functional category : - COG ID : - EC number : - Position : 4619553 - 4619771 bp Length : 219 bp Strand : - Note : similar to Orf2 [Escherichia coli strain E2348/69] gi|2865272|gb|AAC38365.1|, L0053 [Escherichia coli O157:H7 strain EDL933] gi|3414921|gb|AAC31532.1| DNA sequence : ATGATAACGATAACTGAGCTGGAAGATGAAATAATAAAAAATAAAGAAGCCGCAAATGTTTTTATTGAAAAAATAAACGA CAAAAAGAACGAAATCCATGAAAAAATGAAACACCCTTTGGATAAAGTTACCTACGATGAAGCAAAGGAACTGCTCATTG CGTGTGATGCGGCAATTAGGACTATAGAGATAATGCGAATCAGGATTAATAATAAATAG Protein sequence : MITITELEDEIIKNKEAANVFIEKINDKKNEIHEKMKHPLDKVTYDEAKELLIACDAAIRTIEIMRIRINNK |
Gene | GenBank Accn | Product | Virulance or Resistance | PAI or REI | Alignment Type | E-val | Identity |
ECs4587 | NP_312614.1 | hypothetical protein | Not tested | LEE | Protein | 1e-26 | 100 |
unnamed | AAC31532.1 | L0053 | Not tested | LEE | Protein | 1e-26 | 99 |
unnamed | ACU09477.1 | type III secretion system protein YseE family | Virulence | LEE | Protein | 1e-26 | 99 |
ECO111_3771 | YP_003236107.1 | T3SS component | Virulence | LEE | Protein | 2e-26 | 99 |
Z5139 | NP_290287.1 | hypothetical protein | Not tested | LEE | Protein | 2e-26 | 99 |
unnamed | AAC38365.1 | Orf2 | Not tested | LEE | Protein | 1e-26 | 99 |
unnamed | AAK26697.1 | unknown | Not tested | LEE | Protein | 6e-25 | 95 |
unnamed | AAL57524.1 | unknown | Not tested | LEE | Protein | 6e-25 | 95 |
unnamed | AAL57585.1 | unknown | Not tested | LEE | Protein | 6e-25 | 95 |
ECO103_3637 | YP_003223494.1 | T3SS component | Virulence | LEE | Protein | 9e-25 | 95 |
st06 | CAC81844.1 | ST06 protein | Not tested | LEE II | Protein | 6e-25 | 95 |
ECO26_5252 | YP_003232134.1 | T3SS component | Virulence | LEE | Protein | 9e-25 | 95 |
unnamed | CAI43892.1 | hypothetical protein | Not tested | LEE | Protein | 6e-25 | 95 |
unnamed | AAL06350.1 | unknown | Not tested | LEE | Protein | 2e-22 | 88 |
Gene | GenBank Accn | Product | ID of source DB | Alignment Type | E-val | Identity |
ECs4587 | NP_312614.1 | hypothetical protein | VFG0831 | Protein | 5e-27 | 99 |
ECs4587 | NP_312614.1 | hypothetical protein | VFG0711 | Protein | 5e-27 | 99 |