Gene Information

Name : BP2476 (BP2476)
Accession : NP_881103.1
Strain : Bordetella pertussis Tohama I
Genome accession: NC_002929
Putative virulence/resistance : Resistance
Product : mebrane transport protein
Function : -
COG functional category : P : Inorganic ion transport and metabolism
COG ID : COG2076
EC number : -
Position : 2620201 - 2620533 bp
Length : 333 bp
Strand : +
Note : Similar to Escherichia coli quaternary ammonium compound-resistance protein QacE SW:QACE_ECOLI (Q57225) (110 aa) fasta scores: E(): 1.4e-20, 58.18% id in 110 aa and to Pseudomonas aeruginosa GacE2 protein TR:Q9ZEH0 (EMBL:AJ223604) (110 aa) fasta scores: E

DNA sequence :
ATGAACAGCTGGATCCATCTGTCGATGGCCATCGTGGCCGAAATCATCGCCACCAGCGCCCTGAAAAGCTCGGAGGGCTT
CACCCGCCTGCTCCCCTCGCTGGTCACCGTGGCGGGCTACGCGATCGCGTTCTACTTCCTGGCCCTCACGCTGCGGGTCA
TCCCGGTGGGGGTCGCCTACGCCATCTGGTCCGGCGTGGGCATCGTGCTGATCTCGCTGGTTGGCGCGCTGTTGTTCAAG
CAGCACCTGGACCTGCCCGCCATCATCGGCATCGCGCTGATCCTGGCGGGCGTGGTGGTCATGAACGTGTTCTCGAAGTC
CGTCGGCCACTGA

Protein sequence :
MNSWIHLSMAIVAEIIATSALKSSEGFTRLLPSLVTVAGYAIAFYFLALTLRVIPVGVAYAIWSGVGIVLISLVGALLFK
QHLDLPAIIGIALILAGVVVMNVFSKSVGH

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
qacEdelta1 YP_005797134.1 quaternary ammonium compound-resistance protein Not tested AbaR4e Protein 1e-20 64
qacEdelta1 AGK06979.1 QacEdelta1 Not tested SGI1 Protein 8e-21 64
qacE-delta1 ACY75532.1 QacE-delta1 Not tested Tn6060 Protein 8e-21 64
qacEdelta1 ABB48428.1 QacEdelta1 Not tested SGI1 Protein 8e-21 64
qacEdelta1 YP_005797150.1 quaternary ammonium compound-resistance protein Not tested AbaR4e Protein 1e-20 64
qacEdelta1 AGK07016.1 QacEdelta1 Not tested SGI1 Protein 8e-21 64
qacE-delta1 AET25389.1 QacE-delta1 Not tested PAGI-2(C) Protein 8e-21 64
qacEdelta1 ABZ01839.1 QacEdelta1 Not tested SGI2 Protein 8e-21 64
ebr YP_006098377.1 putative ethidium bromide resistance protein Not tested Tn2411 Protein 1e-20 64
qacEdelta1 AGK07074.1 QacEdelta1 Not tested SGI1 Protein 8e-21 64
qacE-delta1 AFG30112.1 QacE-delta1 Not tested PAGI-2 Protein 8e-21 64
qacEdelta1 CAJ77030.1 Quaternary ammonium compound-resistance protein Not tested AbaR1 Protein 8e-21 64
qacEdelta1 ACN81026.1 QacEdelta1 Not tested AbaR5 Protein 1e-20 64
qacEdelta1 AGK07100.1 QacEdelta1 Not tested SGI1 Protein 8e-21 64
qacEdelta1 AGF34989.1 QacEdelta1 Not tested SGI1 Protein 8e-21 64
qacEdelta1 CAJ77049.1 Quaternary ammonium compound-resistance protein Not tested AbaR1 Protein 8e-21 64
qacEdelta1 AGK07109.1 QacEdelta1 Not tested SGI1 Protein 8e-21 64
qacEdelta1 AGF35028.1 QacEdelta1 Not tested SGI1 Protein 8e-21 64
qacEdelta1 CAJ77052.1 Quaternary ammonium compound-resistance protein Not tested AbaR1 Protein 8e-21 64
qacEdelta1 AFV53123.1 QacEdelta1 multidrug exporter Not tested AbGRI2-1 Protein 8e-21 64
qacEdelta1 AGF35063.1 QacEdelta1 Not tested SGI1 Protein 8e-21 64
qacEdelta1 CAJ77088.1 Quaternary ammonium compound-resistance protein Not tested AbaR1 Protein 8e-21 64
qacEdelta1 AGK36647.1 QacEdelta1 Not tested AbaR26 Protein 8e-21 64
qacEdelta1 AGK06933.1 QacEdelta1 Not tested SGI1 Protein 8e-21 64
qacE-deltal ACF06159.1 quartenary ammonium compound resistance protein Not tested Tn5036-like Protein 8e-21 64
qacEdelta1 AAK02047.1 quaternary ammonium compound and disinfectant protein Not tested SGI1 Protein 8e-21 64
ACICU_00227 YP_001844886.1 membrane transporter Not tested AbaR20 Protein 1e-20 64
qacEdelta1 AGK06970.1 QacEdelta1 Not tested SGI1 Protein 8e-21 64
qacE-delta1 ACY75523.1 QacE-delta1 Not tested Tn6060 Protein 8e-21 64
qacEdelta1 AAK02056.1 quaternary ammonium compound and disinfectant protein Not tested SGI1 Protein 8e-21 64
unnamed CAD42068.1 hypothetical protein Not tested PAI II 536 Protein 3e-11 45
unnamed CAD42067.1 hypothetical protein Not tested PAI II 536 Protein 3e-14 44

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
BP2476 NP_881103.1 mebrane transport protein BAC0322 Protein 4e-21 64
BP2476 NP_881103.1 mebrane transport protein BAC0323 Protein 4e-21 64
BP2476 NP_881103.1 mebrane transport protein NC_010410.6003348.p0 Protein 2e-21 63
BP2476 NP_881103.1 mebrane transport protein BAC0002 Protein 2e-21 63
BP2476 NP_881103.1 mebrane transport protein CP001138.1.gene1489. Protein 1e-19 62
BP2476 NP_881103.1 mebrane transport protein BAC0150 Protein 7e-16 59
BP2476 NP_881103.1 mebrane transport protein NC_002695.1.913273.p Protein 6e-16 59
BP2476 NP_881103.1 mebrane transport protein BAC0324 Protein 3e-21 59
BP2476 NP_881103.1 mebrane transport protein BAC0377 Protein 3e-18 55
BP2476 NP_881103.1 mebrane transport protein CP004022.1.gene1549. Protein 3e-18 52
BP2476 NP_881103.1 mebrane transport protein BAC0139 Protein 3e-14 47
BP2476 NP_881103.1 mebrane transport protein BAC0329 Protein 1e-16 45
BP2476 NP_881103.1 mebrane transport protein BAC0327 Protein 3e-16 45
BP2476 NP_881103.1 mebrane transport protein BAC0325 Protein 5e-16 44
BP2476 NP_881103.1 mebrane transport protein BAC0140 Protein 5e-12 44
BP2476 NP_881103.1 mebrane transport protein BAC0321 Protein 3e-17 43
BP2476 NP_881103.1 mebrane transport protein BAC0477 Protein 7e-07 42

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
BP2476 NP_881103.1 mebrane transport protein VFG1587 Protein 1e-11 45
BP2476 NP_881103.1 mebrane transport protein VFG1586 Protein 1e-14 44