Gene Information

Name : mtrA2 (DIP0694)
Accession : NP_939068.1
Strain : Corynebacterium diphtheriae NCTC13129
Genome accession: NC_002935
Putative virulence/resistance : Virulence
Product : two component system response regulator
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG0745
EC number : -
Position : 668619 - 669317 bp
Length : 699 bp
Strand : +
Note : Similar to Mycobacterium tuberculosis MtrA protein or Rv3246c or MTCY20B11.21c TR:Q50447 (EMBL:Z95121) (228 aa) fasta scores: E(): 7.6e-61, 70.66% id in 225 aa, and to Streptomyces coelicolor transcriptional regulatory protein AfsQ1 or 2SCK8.33c SW:AFQ1_S

DNA sequence :
ATGGAAAGGACCACGGACGGTATGGCACCGAAAATTTTGGTTGTCGACGATGATCCCGCGATTTCAGAGATGCTGACCAT
CGTGCTGGAGGCCGAGGGATTTGAGCCGGTCGCGGTCACTGATGGGGCAGTAGCAGTTGATGCCTTTAGGACAGAATCGC
CTGATCTAGTCCTACTCGATTTGATGCTGCCTGGTATGAATGGCATCGACATTTGTAGGATAATCCGGCAGGAATCGGCA
GTTCCTATCGTCATGCTCACGGCGAAAACCGACACCGTGGACGTAGTCCTTGGTTTGGAATCAGGTGCAGATGACTACAT
CAACAAGCCGTTTAAGCCGAAAGAACTCATCGCTCGACTACGTGCACGCTTGCGTCGTACAGAGGACTCTCCGTCCGAAA
CCATTGAGATCGGGGATCTTACGATCGACGTCCTAGGCCACGAAGTCACTCGAGGAGATGAGGAAATTCAACTCACTCCT
TTAGAGTTTGATTTGCTGCTTGAGCTTGCAAGCAAACCAGGACAGGTGTTCACACGTGAGGAACTTCTGCAAAAAGTTTG
GGGCTACCGTAATGCCTCAGACACGAGACTGGTGAATGTCCATGTGCAGCGACTGCGCTCAAAGATCGAGAAAGACCCAG
AAAACCCGCACATCGTGTTAACAGTGCGCGGAGTGGGGTATAAGACAGGGCAGGAGTAG

Protein sequence :
MERTTDGMAPKILVVDDDPAISEMLTIVLEAEGFEPVAVTDGAVAVDAFRTESPDLVLLDLMLPGMNGIDICRIIRQESA
VPIVMLTAKTDTVDVVLGLESGADDYINKPFKPKELIARLRARLRRTEDSPSETIEIGDLTIDVLGHEVTRGDEEIQLTP
LEFDLLLELASKPGQVFTREELLQKVWGYRNASDTRLVNVHVQRLRSKIEKDPENPHIVLTVRGVGYKTGQE

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
unnamed CAD42044.1 hypothetical protein Not tested PAI II 536 Protein 3e-31 44
c3565 NP_755440.1 response regulator Not tested PAI I CFT073 Protein 2e-31 44

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
mtrA2 NP_939068.1 two component system response regulator AE000516.2.gene3505. Protein 2e-63 71
mtrA2 NP_939068.1 two component system response regulator NC_012469.1.7685629. Protein 3e-36 48
mtrA2 NP_939068.1 two component system response regulator NC_002952.2859905.p0 Protein 3e-36 47
mtrA2 NP_939068.1 two component system response regulator NC_003923.1003749.p0 Protein 1e-36 47
mtrA2 NP_939068.1 two component system response regulator NC_002758.1121668.p0 Protein 2e-36 47
mtrA2 NP_939068.1 two component system response regulator NC_009641.5332272.p0 Protein 2e-36 47
mtrA2 NP_939068.1 two component system response regulator NC_013450.8614421.p0 Protein 2e-36 47
mtrA2 NP_939068.1 two component system response regulator NC_007793.3914279.p0 Protein 2e-36 47
mtrA2 NP_939068.1 two component system response regulator NC_007622.3794472.p0 Protein 2e-36 47
mtrA2 NP_939068.1 two component system response regulator NC_002745.1124361.p0 Protein 2e-36 47
mtrA2 NP_939068.1 two component system response regulator NC_009782.5559369.p0 Protein 2e-36 47
mtrA2 NP_939068.1 two component system response regulator NC_002951.3237708.p0 Protein 2e-36 47
mtrA2 NP_939068.1 two component system response regulator HE999704.1.gene2815. Protein 9e-35 47
mtrA2 NP_939068.1 two component system response regulator NC_012469.1.7686381. Protein 3e-32 44
mtrA2 NP_939068.1 two component system response regulator CP000675.2.gene1535. Protein 3e-26 42
mtrA2 NP_939068.1 two component system response regulator AF155139.2.orf0.gene Protein 7e-28 42
mtrA2 NP_939068.1 two component system response regulator BAC0125 Protein 2e-25 42
mtrA2 NP_939068.1 two component system response regulator NC_002951.3238224.p0 Protein 1e-28 41
mtrA2 NP_939068.1 two component system response regulator NC_007793.3914065.p0 Protein 1e-28 41
mtrA2 NP_939068.1 two component system response regulator NC_002758.1121390.p0 Protein 1e-28 41
mtrA2 NP_939068.1 two component system response regulator NC_010079.5776364.p0 Protein 1e-28 41
mtrA2 NP_939068.1 two component system response regulator NC_002952.2859858.p0 Protein 1e-28 41
mtrA2 NP_939068.1 two component system response regulator NC_007622.3794948.p0 Protein 1e-28 41
mtrA2 NP_939068.1 two component system response regulator NC_003923.1003417.p0 Protein 1e-28 41
mtrA2 NP_939068.1 two component system response regulator NC_013450.8614146.p0 Protein 1e-28 41
mtrA2 NP_939068.1 two component system response regulator HE999704.1.gene1528. Protein 5e-27 41
mtrA2 NP_939068.1 two component system response regulator BAC0111 Protein 9e-21 41
mtrA2 NP_939068.1 two component system response regulator AE016830.1.gene1681. Protein 6e-33 41
mtrA2 NP_939068.1 two component system response regulator BAC0083 Protein 5e-21 41
mtrA2 NP_939068.1 two component system response regulator CP000034.1.gene3671. Protein 3e-28 41
mtrA2 NP_939068.1 two component system response regulator CP001918.1.gene5135. Protein 1e-14 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
mtrA2 NP_939068.1 two component system response regulator VFG1563 Protein 2e-31 44
mtrA2 NP_939068.1 two component system response regulator VFG1702 Protein 7e-32 44
mtrA2 NP_939068.1 two component system response regulator VFG1390 Protein 1e-26 43
mtrA2 NP_939068.1 two component system response regulator VFG1389 Protein 9e-20 41