Gene Information

Name : DIP0854 (DIP0854)
Accession : NP_939218.1
Strain : Corynebacterium diphtheriae NCTC13129
Genome accession: NC_002935
Putative virulence/resistance : Virulence
Product : two component system response regulator
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG0745
EC number : -
Position : 827685 - 828377 bp
Length : 693 bp
Strand : +
Note : Similar to Corynebacterium glutamicum response regulator TR:Q9F161 (EMBL:AF119221) (232 aa) fasta scores: E(): 2.4e-67, 79.31% id in 232 aa, and to Pseudomonas syringae transcriptional activator protein CopR SW:COPR_PSESM (Q02540) (227 aa) fasta scores: E

DNA sequence :
ATGAAGATTGTGGTCGTAGATGATGAGCAGGCGGTGCGCGAGTCGCTTTGTCGTTCGTTGTCCTTTAACGGATATGAAGT
GCATCTGGCTCAAGATGGAGTCGAGGCACTTGAAGTAATTGAACGTGAACAACCAGAGCTGGTCATCCTTGACGTGATGA
TGCCACGCATGGATGGTCTTGAGGTTTGCCGCACCTTGCGTGGTAGCGGTGACGACCGTCCGATTTTGGTTCTGACCGCT
CGCGATGGTGTGTCTGATCGTGTTGCCGGCCTTGATGCTGGTGCAGACGACTACCTTCCTAAGCCATTCGCACTTGAGGA
GCTACTAGCTCGTGTGCGTTCCCTGCTTCGCCGTGCCGCTGCAGAGTCCGTCGGCTCCGGCAGCCAAGGGGAGCTTTCCT
TTGAGGATCTTCGCCTAAACCCCGATACGCGCGATGTCACCCGCGGTGGTCGCCCTATTAGCTTGACTCGCACTGAGTTT
GCGCTGCTCCAGTTGCTGATGGCGAATTCTCGTCGCGTACTTTCGCGTGCGTCGATCTTGGAAGAAGTGTGGGGATATGA
CTTCCCAACTTCTGGAAACGCACTGGAAGTCTATATTGGCTATTTGCGTCGCAAGACTGAATCAGAAGGGGAGCCACGTT
TGATCCATACCGTTCGCGGTGTTGGCTACGTGCTGAGGGAAACTGCGCCGTGA

Protein sequence :
MKIVVVDDEQAVRESLCRSLSFNGYEVHLAQDGVEALEVIEREQPELVILDVMMPRMDGLEVCRTLRGSGDDRPILVLTA
RDGVSDRVAGLDAGADDYLPKPFALEELLARVRSLLRRAAAESVGSGSQGELSFEDLRLNPDTRDVTRGGRPISLTRTEF
ALLQLLMANSRRVLSRASILEEVWGYDFPTSGNALEVYIGYLRRKTESEGEPRLIHTVRGVGYVLRETAP

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
copR NP_460069.2 transcriptional regulatory protein YedW Not tested SPI-5 Protein 1e-32 43
copR AAC33719.1 regulatory protein CopR Not tested SPI-5 Protein 4e-32 42

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
DIP0854 NP_939218.1 two component system response regulator BAC0083 Protein 2e-32 48
DIP0854 NP_939218.1 two component system response regulator BAC0125 Protein 9e-33 45
DIP0854 NP_939218.1 two component system response regulator BAC0197 Protein 2e-30 45
DIP0854 NP_939218.1 two component system response regulator HE999704.1.gene1528. Protein 3e-36 44
DIP0854 NP_939218.1 two component system response regulator NC_002952.2859905.p0 Protein 8e-38 44
DIP0854 NP_939218.1 two component system response regulator NC_009782.5559369.p0 Protein 8e-38 44
DIP0854 NP_939218.1 two component system response regulator NC_002951.3237708.p0 Protein 8e-38 44
DIP0854 NP_939218.1 two component system response regulator NC_002758.1121668.p0 Protein 8e-38 44
DIP0854 NP_939218.1 two component system response regulator NC_009641.5332272.p0 Protein 8e-38 44
DIP0854 NP_939218.1 two component system response regulator NC_013450.8614421.p0 Protein 8e-38 44
DIP0854 NP_939218.1 two component system response regulator NC_007793.3914279.p0 Protein 8e-38 44
DIP0854 NP_939218.1 two component system response regulator NC_007622.3794472.p0 Protein 8e-38 44
DIP0854 NP_939218.1 two component system response regulator NC_003923.1003749.p0 Protein 7e-38 44
DIP0854 NP_939218.1 two component system response regulator NC_002745.1124361.p0 Protein 8e-38 44
DIP0854 NP_939218.1 two component system response regulator BAC0308 Protein 3e-33 43
DIP0854 NP_939218.1 two component system response regulator BAC0111 Protein 3e-34 43
DIP0854 NP_939218.1 two component system response regulator AE000516.2.gene3505. Protein 2e-32 42
DIP0854 NP_939218.1 two component system response regulator NC_013450.8614146.p0 Protein 8e-32 41
DIP0854 NP_939218.1 two component system response regulator NC_002951.3238224.p0 Protein 8e-32 41
DIP0854 NP_939218.1 two component system response regulator NC_007793.3914065.p0 Protein 8e-32 41
DIP0854 NP_939218.1 two component system response regulator NC_002758.1121390.p0 Protein 8e-32 41
DIP0854 NP_939218.1 two component system response regulator NC_010079.5776364.p0 Protein 8e-32 41
DIP0854 NP_939218.1 two component system response regulator NC_002952.2859858.p0 Protein 8e-32 41
DIP0854 NP_939218.1 two component system response regulator NC_007622.3794948.p0 Protein 8e-32 41
DIP0854 NP_939218.1 two component system response regulator NC_003923.1003417.p0 Protein 8e-32 41
DIP0854 NP_939218.1 two component system response regulator CP000034.1.gene3671. Protein 3e-32 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
DIP0854 NP_939218.1 two component system response regulator VFG1390 Protein 3e-73 74
DIP0854 NP_939218.1 two component system response regulator VFG1386 Protein 2e-44 50
DIP0854 NP_939218.1 two component system response regulator VFG1389 Protein 2e-39 49
DIP0854 NP_939218.1 two component system response regulator VFG0596 Protein 5e-33 43