Gene Information

Name : GSU0451 (GSU0451)
Accession : NP_951510.1
Strain : Geobacter sulfurreducens PCA
Genome accession: NC_002939
Putative virulence/resistance : Virulence
Product : winged-helix transcriptional response regulator
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG0745
EC number : -
Position : 481049 - 481723 bp
Length : 675 bp
Strand : +
Note : domains: REC, trans_reg_C

DNA sequence :
ATGAAGGTTCTCGTGGTCGAAGATGAGAAGAAGGTGTCCAGCTTCATCAAGCGGGGGCTCGAGGAAGAGAAGTACGAGGT
CGATGCCGCGTTCAACGGCGAGGAAGGGCTCAAGATGGCCCTGGACAAGGGCTACGATCTGATCGTTCTCGACGTGATGC
TGCCCAAAAAGGATGGTCTCAGCGTGGTACGTGAGCTCCGGGAGCGCAAGAACAGCACACCGGTTCTGATGCTGACAGCC
AAGGACTCGGTGGAGGATATCGTGGCCGGTCTCGATTCGGGTTCCGACGACTACCTGACCAAGCCCTTCGCTTTTGCTGA
GCTTCTGGCCCGGGTCCGGGCCTTGGTGCGTCGCAGCGAGCAGGATCGCGGGGCAGAGATCCGCTTTGCTGATCTGCGGC
TCGACCCGGTGACCCACAAGGTCTGGCGCAAGGACAAAGAGATCGACCTCACCGCCAAGGAGTATTCGCTGCTCGAGTAC
TTCATGCGGAACCCCAACCAGGTCCTTACCCGCACCATGATCGCCGAGCACGTGTGGGACTACACCTTTGACAGCTTCAC
CAATATCATTGACGTCTACGTCAACTACCTGCGCAAGAAGATCGACCGGGAGTCCGACAAGAAGCTCATCCACACCGTCC
GCGGCGTGGGCTATATCCTGAAGGAGGAGGATTGA

Protein sequence :
MKVLVVEDEKKVSSFIKRGLEEEKYEVDAAFNGEEGLKMALDKGYDLIVLDVMLPKKDGLSVVRELRERKNSTPVLMLTA
KDSVEDIVAGLDSGSDDYLTKPFAFAELLARVRALVRRSEQDRGAEIRFADLRLDPVTHKVWRKDKEIDLTAKEYSLLEY
FMRNPNQVLTRTMIAEHVWDYTFDSFTNIIDVYVNYLRKKIDRESDKKLIHTVRGVGYILKEED

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
copR NP_460069.2 transcriptional regulatory protein YedW Not tested SPI-5 Protein 1e-33 46
copR AAC33719.1 regulatory protein CopR Not tested SPI-5 Protein 1e-32 45

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
GSU0451 NP_951510.1 winged-helix transcriptional response regulator BAC0111 Protein 2e-41 52
GSU0451 NP_951510.1 winged-helix transcriptional response regulator BAC0125 Protein 4e-41 51
GSU0451 NP_951510.1 winged-helix transcriptional response regulator BAC0308 Protein 8e-38 51
GSU0451 NP_951510.1 winged-helix transcriptional response regulator BAC0347 Protein 3e-35 49
GSU0451 NP_951510.1 winged-helix transcriptional response regulator BAC0638 Protein 5e-33 49
GSU0451 NP_951510.1 winged-helix transcriptional response regulator BAC0197 Protein 4e-36 49
GSU0451 NP_951510.1 winged-helix transcriptional response regulator NC_002951.3238224.p0 Protein 1e-34 44
GSU0451 NP_951510.1 winged-helix transcriptional response regulator NC_007793.3914065.p0 Protein 1e-34 44
GSU0451 NP_951510.1 winged-helix transcriptional response regulator NC_002758.1121390.p0 Protein 1e-34 44
GSU0451 NP_951510.1 winged-helix transcriptional response regulator NC_010079.5776364.p0 Protein 1e-34 44
GSU0451 NP_951510.1 winged-helix transcriptional response regulator NC_002952.2859858.p0 Protein 1e-34 44
GSU0451 NP_951510.1 winged-helix transcriptional response regulator AE015929.1.gene1106. Protein 7e-29 44
GSU0451 NP_951510.1 winged-helix transcriptional response regulator NC_007622.3794948.p0 Protein 1e-34 44
GSU0451 NP_951510.1 winged-helix transcriptional response regulator NC_003923.1003417.p0 Protein 1e-34 44
GSU0451 NP_951510.1 winged-helix transcriptional response regulator NC_013450.8614146.p0 Protein 1e-34 44
GSU0451 NP_951510.1 winged-helix transcriptional response regulator BAC0083 Protein 1e-40 44
GSU0451 NP_951510.1 winged-helix transcriptional response regulator NC_002952.2859905.p0 Protein 4e-34 43
GSU0451 NP_951510.1 winged-helix transcriptional response regulator NC_002951.3237708.p0 Protein 6e-34 43
GSU0451 NP_951510.1 winged-helix transcriptional response regulator NC_007622.3794472.p0 Protein 4e-34 43
GSU0451 NP_951510.1 winged-helix transcriptional response regulator NC_002758.1121668.p0 Protein 6e-34 43
GSU0451 NP_951510.1 winged-helix transcriptional response regulator NC_009641.5332272.p0 Protein 6e-34 43
GSU0451 NP_951510.1 winged-helix transcriptional response regulator NC_013450.8614421.p0 Protein 6e-34 43
GSU0451 NP_951510.1 winged-helix transcriptional response regulator NC_007793.3914279.p0 Protein 6e-34 43
GSU0451 NP_951510.1 winged-helix transcriptional response regulator NC_003923.1003749.p0 Protein 7e-34 43
GSU0451 NP_951510.1 winged-helix transcriptional response regulator NC_002745.1124361.p0 Protein 6e-34 43
GSU0451 NP_951510.1 winged-helix transcriptional response regulator NC_009782.5559369.p0 Protein 6e-34 43
GSU0451 NP_951510.1 winged-helix transcriptional response regulator HE999704.1.gene1528. Protein 5e-36 42
GSU0451 NP_951510.1 winged-helix transcriptional response regulator NC_012469.1.7685629. Protein 4e-25 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
GSU0451 NP_951510.1 winged-helix transcriptional response regulator VFG1390 Protein 5e-46 50
GSU0451 NP_951510.1 winged-helix transcriptional response regulator VFG0596 Protein 5e-34 46
GSU0451 NP_951510.1 winged-helix transcriptional response regulator VFG1386 Protein 6e-40 41