Gene Information

Name : SACOL0473 (SACOL0473)
Accession : YP_185363.1
Strain : Staphylococcus aureus COL
Genome accession: NC_002951
Putative virulence/resistance : Virulence
Product : superantigen-like protein
Function : -
COG functional category : -
COG ID : -
EC number : -
Position : 475038 - 475736 bp
Length : 699 bp
Strand : +
Note : these proteins share structural homology to known superantigen proteins but do not exhibit any of the properties expected such as histocompatibility complex class II binding or broad T-cell activation

DNA sequence :
ATGAAATTAACAACGATAGCTAAAGCAACATTAGCATTAGGAATATTAACTACAGGTGTGTTTACAGCAGAAAGTCAAAC
TGGTCACGCGAAAGTAGAACTTGATGAGACACAACGCAAATATTATATCAATATGCTACATCAATACTATTCTGAAGAAA
GTTTTGAACCAACAAACATTAGTGTTAAAAGCGAAGATTACTATGGCTCTAACGTTTTAAACTTTAAACAACGAAATAAA
GCTTTTAAAGTATTTTTACTTGGTGACGATAAAAATAAATATAAAGAAAAAACACATGGCCTTGATGTCTTTGCAGTACC
TGAATTAATAGATATAAAAGGTGGCATATATAGCGTTGGCGGTATAACAAAGAAAAATGTGAGATCAGTGTTTGGATTTG
TAAGTAATCCAAGTCTACAAGTTAAAAAAGTTGATGCTAAAAATGGCTTTTCGATAAACGAGTTGTTTTTTATTCAAAAG
GAAGAAGTATCATTGAAGGAACTGGACTTTAAAATAAGAAAACTCTTAATCGAAAAATATAGATTGTATAAAGGAACGTC
TGATAAAGGTAGAATTGTTATCAATATGAAAGACGAAAAGAAGCATGAAATTGATTTAAGTGAAAAATTAAGTTTTGAAC
GTATGTTTGATGTAATGGATAGTAAGCAAATTAAAAATATTGAAGTGAATTTGAATTAG

Protein sequence :
MKLTTIAKATLALGILTTGVFTAESQTGHAKVELDETQRKYYINMLHQYYSEESFEPTNISVKSEDYYGSNVLNFKQRNK
AFKVFLLGDDKNKYKEKTHGLDVFAVPELIDIKGGIYSVGGITKKNVRSVFGFVSNPSLQVKKVDAKNGFSINELFFIQK
EEVSLKELDFKIRKLLIEKYRLYKGTSDKGRIVINMKDEKKHEIDLSEKLSFERMFDVMDSKQIKNIEVNLN

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
SACOL0473 YP_185363.1 superantigen-like protein Virulence vSa¥á Protein 4e-104 100
set9nm YP_001331430.1 superantigen-like protein Virulence vSa¥á Protein 4e-104 100
SAUSA300_0403 YP_493117.1 superantigen-like protein Virulence vSa¥á Protein 4e-104 100
SAKOR_00412 YP_008490596.1 Exotoxin Virulence vSa¥á Protein 4e-101 97
set13 NP_370952.1 superantigen-like protein Virulence vSa¥á Protein 4e-99 94
set13 NP_373639.1 superantigen-like protein Virulence vSa¥á Protein 4e-99 94
SAS0392 YP_042517.1 superantigen-like protein Virulence vSa¥á Protein 5e-99 94
set24 NP_645207.1 superantigen-like protein Virulence vSa¥á Protein 5e-99 94
set5 YP_039881.1 superantigen-like protein Virulence vSa¥á Protein 3e-94 88
set8nm YP_001331429.2 superantigen-like protein Virulence vSa¥á Protein 4e-70 67
SAUSA300_0402 YP_493116.1 superantigen-like protein Virulence vSa¥á Protein 4e-70 67
set12 NP_370951.1 superantigen-like protein Virulence vSa¥á Protein 2e-70 67
set12 NP_373638.1 superantigen-like protein Virulence vSa¥á Protein 2e-70 67
SAS0391 YP_042516.2 superantigen-like protein Virulence vSa¥á Protein 1e-69 67
set23 NP_645206.1 superantigen-like protein Virulence vSa¥á Protein 1e-69 67
SAKOR_00411 YP_008490595.1 Exotoxin Virulence vSa¥á Protein 7e-70 67
set7nm YP_001331428.1 superantigen-like protein 7 Virulence vSa¥á Protein 2e-49 57
SAUSA300_0401 YP_493115.1 superantigen-like protein 7 Virulence vSa¥á Protein 2e-49 57
set11 NP_370950.1 superantigen-like protein 7 Virulence vSa¥á Protein 6e-44 57
set11 NP_373637.1 superantigen-like protein 7 Virulence vSa¥á Protein 6e-44 57
SAKOR_00410 YP_008490594.1 Exotoxin Virulence vSa¥á Protein 7e-50 56
SAMSHR1132_03760 YP_005324898.1 exotoxin 1 Virulence vSa¥á Protein 3e-49 55
set22 NP_645205.1 superantigen-like protein 7 Virulence vSa¥á Protein 1e-47 55
SAS0390 YP_042515.1 superantigen-like protein 7 Virulence vSa¥á Protein 1e-47 55
set1 YP_039880.1 superantigen-like protein 7 Virulence vSa¥á Protein 3e-50 53
set4 YP_039882.1 superantigen-like protein Virulence vSa¥á Protein 4e-32 50
SAMSHR1132_03770 YP_005324899.1 exotoxin 4 Virulence vSa¥á Protein 2e-27 49
SAUSA300_0404 YP_493118.1 superantigen-like protein Virulence vSa¥á Protein 4e-30 46
SAS0393 YP_042518.1 superantigen-like protein Virulence vSa¥á Protein 8e-31 46
set25 NP_645208.1 superantigen-like protein Virulence vSa¥á Protein 8e-31 46
SACOL0474 YP_185364.1 superantigen-like protein Virulence vSa¥á Protein 4e-30 46
set14 NP_370953.1 superantigen-like protein Virulence vSa¥á Protein 4e-30 46
set14 NP_373640.1 superantigen-like protein Virulence vSa¥á Protein 4e-30 46
set10nm YP_001331431.1 superantigen-like protein Virulence vSa¥á Protein 4e-30 46
SAKOR_00413 YP_008490597.1 Exotoxin Virulence vSa¥á Protein 9e-31 46
SAUSA300_0400 YP_493114.1 superantigen-like protein Virulence vSa¥á Protein 3e-25 41
set6nm YP_001331427.1 superantigen-like protein Virulence vSa¥á Protein 3e-25 41
set15 NP_370957.1 superantigen-like protein Virulence vSa¥á Protein 5e-26 41
set15 NP_373644.1 superantigen-like protein Virulence vSa¥á Protein 5e-26 41