Gene Information

Name : SAR2573 (SAR2573)
Accession : YP_041921.1
Strain : Staphylococcus aureus MRSA252
Genome accession: NC_002952
Putative virulence/resistance : Virulence
Product : lipoprotein
Function : -
COG functional category : -
COG ID : -
EC number : -
Position : 2652402 - 2653178 bp
Length : 777 bp
Strand : -
Note : No significant database matches. Similar to SAR2570, 69.884% identity (70.428% ungapped) in 259 aa overlap, SAR0444, 63.922% identity (64.427% ungapped) in 255 aa overlap, SAR0106, 59.846% identity (61.265% ungapped) in 259 aa overlap, and to SAR0445, 50.

DNA sequence :
ATGATGATTCATTCAAAAAGGTTGAAAATGTGTCTATGCTTGATAATACTATCTGTTTTTATAGGGGCTTGCGGAATGAA
AAAAGAAGAAAGTAGTAAAGATAAACAAATTAAAGAAAACTTCAACAAAACGTTGAGCCTGTATCCAACTAAAAATCTTG
AAGACTTTTATGATAAGGAAGGATTTCGTGACGAAGAGTTTGATAAAGGAGATAAAGGCACTTGGATTGTTGATTCTGAG
ATGGTAGTTGAGCTGAAGGATAAAAAAATGGAATCTAGAAGTATGGTGCTCTATATAAATCGTAATACTAGAACAACGAA
AGGTAATTTTATTGTTAGAGAATTGTGGGAAGATAGTAAAGGGTATGCACAAAGTAAAGATACAAAATATCCAGTGAAAA
TGGAACATAATCGAATTATCCCAACCAAACAGATAGCTGATGATAAATTAAGAAAAGAAATCGAAAACTTTAAATTTTTT
GTACAATACGGTGACTTTAAAGATATTAATGATTATAAAGATGGTGACATTTCATATAATCCAAATGTACCTAGTTATTC
AGCAGAATATCAATTGAGTAACAATGACTACAATGTGAAGCAACTTAGAAAGAGGTATAATATACCAACTAAGAAAGCAC
CTAAATTATTAATAAAAGGTGATGGTGATTTAAAAGGATCATCTATAGGACACAAAAATTTAGAGTTTACCTTTGTAGAA
AACAAAGAAGAAAACATCTATTTTACGGATAGTATTAATTTCAAACCTACTGAATAG

Protein sequence :
MMIHSKRLKMCLCLIILSVFIGACGMKKEESSKDKQIKENFNKTLSLYPTKNLEDFYDKEGFRDEEFDKGDKGTWIVDSE
MVVELKDKKMESRSMVLYINRNTRTTKGNFIVRELWEDSKGYAQSKDTKYPVKMEHNRIIPTKQIADDKLRKEIENFKFF
VQYGDFKDINDYKDGDISYNPNVPSYSAEYQLSNNDYNVKQLRKRYNIPTKKAPKLLIKGDGDLKGSSIGHKNLEFTFVE
NKEENIYFTDSINFKPTE

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
SAMSHR1132_03920 YP_005324913.1 putative lipoprotein Not tested vSa¥á Protein 7e-74 66
SAR0444 YP_039893.1 lipoprotein Not tested vSa¥á Protein 3e-77 66
lpl8 NP_370968.1 hypothetical protein Not tested vSa¥á Protein 3e-76 65
lpl8 NP_373655.1 hypothetical protein Not tested vSa¥á Protein 3e-76 65
SACOL0485 YP_185375.1 hypothetical protein Not tested vSa¥á Protein 8e-75 64
lpl8nm YP_001331445.1 tandem lipoprotein Not tested vSa¥á Protein 8e-75 64
SAUSA300_0418 YP_493131.1 tandem lipoprotein Not tested vSa¥á Protein 8e-75 64
SACOL0483 YP_185373.1 staphyloccoccus tandem lipoprotein Not tested vSa¥á Protein 1e-75 63
lpl6nm YP_001331443.1 tandem lipoprotein Not tested vSa¥á Protein 1e-75 63
SAUSA300_0416 YP_493129.1 tandem lipoprotein Not tested vSa¥á Protein 1e-75 63
lpl13 NP_645217.1 hypothetical protein Not tested vSa¥á Protein 2e-76 62
SAMSHR1132_03850 YP_005324906.1 putative lipoprotein Not tested vSa¥á Protein 3e-76 62
SAS0402 YP_042528.1 lipoprotein Not tested vSa¥á Protein 2e-76 62
SAKOR_00421 YP_008490605.1 Membrane lipoprotein Not tested vSa¥á Protein 3e-69 61
unnamed AAL26686.1 unknown Not tested SCCcap1 Protein 4e-74 60
lpl3 NP_373649.1 hypothetical protein Virulence vSa¥á Protein 6e-75 60
lpl3 NP_370962.1 hypothetical protein Not tested vSa¥á Protein 6e-75 60
SAMSHR1132_03880 YP_005324909.1 putative lipoprotein Not tested vSa¥á Protein 4e-74 60
SAMSHR1132_03910 YP_005324912.1 putative lipoprotein Not tested vSa¥á Protein 3e-74 58
SACOL0482 YP_185372.1 hypothetical protein Not tested vSa¥á Protein 2e-74 58
lpl5nm YP_001331442.1 tandem lipoprotein Not tested vSa¥á Protein 2e-74 58
lpl3 YP_493128.1 tandem lipoprotein Not tested vSa¥á Protein 4e-74 58
lpl5 NP_370965.1 hypothetical protein Not tested vSa¥á Protein 2e-55 51
lpl5 NP_373652.1 hypothetical protein Not tested vSa¥á Protein 2e-55 51
lpl14 NP_645218.1 hypothetical protein Not tested vSa¥á Protein 2e-50 51
SAR0445 YP_039894.1 lipoprotein Not tested vSa¥á Protein 4e-65 50
SAUSA300_0414 YP_493127.1 tandem lipoprotein Not tested vSa¥á Protein 2e-53 49
SAS0400 YP_042526.1 hypothetical protein Not tested vSa¥á Protein 9e-53 49
lpl11 NP_645215.1 hypothetical protein Not tested vSa¥á Protein 9e-53 49
SAR0442 YP_039891.1 hypothetical protein Not tested vSa¥á Protein 5e-54 49
lpl4nm YP_001331441.1 tandem lipoprotein Not tested vSa¥á Protein 2e-52 48
SAMSHR1132_03900 YP_005324911.1 putative lipoprotein Not tested vSa¥á Protein 5e-55 48
SAV0440 NP_370964.1 hypothetical protein Not tested vSa¥á Protein 2e-55 48
lpl4 NP_373651.1 hypothetical protein Not tested vSa¥á Protein 4e-55 48
SAS0403 YP_042529.1 lipoprotein Not tested vSa¥á Protein 1e-56 48
lpl2nm YP_001331438.1 tandem lipoprotein Not tested vSa¥á Protein 2e-51 48
SAUSA300_0411 YP_493125.1 tandem lipoprotein Not tested vSa¥á Protein 4e-52 48
SACOL0481 YP_185371.1 hypothetical protein Not tested vSa¥á Protein 8e-51 48
SAR0443 YP_039892.1 lipoprotein Not tested vSa¥á Protein 1e-53 48
SAKOR_00420 YP_008490604.1 Membrane lipoprotein Not tested vSa¥á Protein 2e-52 48
SAMSHR1132_03930 YP_005324914.1 hypothetical protein Not tested vSa¥á Protein 6e-53 47
lpl7 NP_373654.1 hypothetical protein Not tested vSa¥á Protein 9e-54 47
SAKOR_00425 YP_008490609.1 Membrane lipoprotein Not tested vSa¥á Protein 9e-54 47
lpl7 NP_370967.1 hypothetical protein Not tested vSa¥á Protein 9e-54 47
SAS0399 YP_042525.1 lipoprotein Not tested vSa¥á Protein 5e-52 47
lpl10 NP_645214.1 hypothetical protein Not tested vSa¥á Protein 5e-52 47
SAKOR_00424 YP_008490608.1 Membrane lipoprotein Not tested vSa¥á Protein 3e-49 47
lpl6 NP_370966.1 hypothetical protein Not tested vSa¥á Protein 8e-55 46
lpl6 NP_373653.1 hypothetical protein Not tested vSa¥á Protein 8e-55 46
SAR0438 YP_039889.1 lipoprotein Not tested vSa¥á Protein 6e-54 46
lpl12 NP_645216.1 hypothetical protein Not tested vSa¥á Protein 4e-54 46
SACOL0484 YP_185374.1 hypothetical protein Not tested vSa¥á Protein 2e-54 46
SAMSHR1132_03940 YP_005324915.1 putative lipoprotein Not tested vSa¥á Protein 2e-52 46
lpl7nm YP_001331444.1 tandem lipoprotein Not tested vSa¥á Protein 2e-54 46
SAUSA300_0417 YP_493130.1 tandem lipoprotein Not tested vSa¥á Protein 2e-54 46
SAS0401 YP_042527.1 lipoprotein Not tested vSa¥á Protein 4e-54 46
lpl2 NP_370961.1 hypothetical protein Not tested vSa¥á Protein 4e-53 46
lpl2 NP_373648.1 hypothetical protein Virulence vSa¥á Protein 4e-53 46
SAMSHR1132_03890 YP_005324910.1 putative lipoprotein Not tested vSa¥á Protein 2e-52 46
SAKOR_00422 YP_008490606.1 Membrane lipoprotein Not tested vSa¥á Protein 3e-53 46
SAMSHR1132_03840 YP_005324905.1 putative lipoprotein Not tested vSa¥á Protein 1e-52 46
lpl1 NP_370960.1 hypothetical protein Not tested vSa¥á Protein 1e-47 46
lpl1 NP_373647.1 hypothetical protein Virulence vSa¥á Protein 1e-47 46
SAR0439 YP_039890.1 lipoprotein Not tested vSa¥á Protein 7e-52 45
lpl3nm YP_001331440.1 tandem lipoprotein Not tested vSa¥á Protein 8e-54 45
SAUSA300_0413 YP_493126.1 tandem lipoprotein Not tested vSa¥á Protein 2e-53 45
lpl9 NP_370969.1 hypothetical protein Not tested vSa¥á Protein 5e-54 45
lpl9 NP_373656.1 hypothetical protein Not tested vSa¥á Protein 5e-54 45
SAKOR_00423 YP_008490607.1 Membrane lipoprotein Not tested vSa¥á Protein 7e-51 45
SAMSHR1132_03870 YP_005324908.1 putative lipoprotein Not tested vSa¥á Protein 2e-50 45
SAUSA300_0410 YP_493124.1 tandem lipoprotein Not tested vSa¥á Protein 4e-50 45
lpl1nm YP_001331437.1 tandem lipoprotein Not tested vSa¥á Protein 8e-51 45
SAKOR_00428 YP_008490612.1 Membrane lipoprotein Not tested vSa¥á Protein 8e-54 45
SAUSA300_0419 YP_493132.1 tandem lipoprotein Not tested vSa¥á Protein 3e-52 44
lpl9nm YP_001331446.1 tandem lipoprotein Not tested vSa¥á Protein 3e-52 44
SACOL0486 YP_185376.1 hypothetical protein Not tested vSa¥á Protein 5e-53 44
SAMSHR1132_03860 YP_005324907.1 putative lipoprotein Not tested vSa¥á Protein 1e-49 43