Gene Information

Name : SAR0706 (SAR0706)
Accession : YP_040140.1
Strain : Staphylococcus aureus MRSA252
Genome accession: NC_002952
Putative virulence/resistance : Unknown
Product : hypothetical protein
Function : -
COG functional category : -
COG ID : -
EC number : -
Position : 746977 - 747081 bp
Length : 105 bp
Strand : -
Note : No significant database matches. Similar to SAR1888, 50.000% identity (50.000% ungapped) in 28 aa overlap, and to SAR0716, 55.556% identity (55.556% ungapped) in 27 aa overlap

DNA sequence :
GTGCGATTTATGAATGAAATTCTTGTTCACATCATGACAACGGCAATCAGTGGTTGTCTCGTTACGTTATTTGGTTATTG
GCTCCATAAACGTGATAAAAAATAA

Protein sequence :
MRFMNEILVHIMTTAISGCLVTLFGYWLHKRDKK

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
SH2616 YP_254531.1 hypothetical protein Not tested ¥ðSh2 Protein 7e-06 65
SH2604 YP_254519.1 hypothetical protein Not tested ¥ðSh2 Protein 8e-05 62
SH2302 YP_254217.1 hypothetical protein Not tested ¥ðSh1 Protein 1e-04 62
SERP2235 YP_189788.1 hypothetical protein Not tested vSe1 Protein 0.010 50