
|
Name : SAS0035 (SAS0035) Accession : YP_042168.1 Strain : Staphylococcus aureus MSSA476 Genome accession: NC_002953 Putative virulence/resistance : Unknown Product : hypothetical protein Function : - COG functional category : - COG ID : - EC number : - Position : 47784 - 48080 bp Length : 297 bp Strand : - Note : Ortholog of S. aureus MRSA252 (BX571856) SAR0062; Similar to Staphylococcus aureus hypothetical 11.1 kDa protein SWALL:Q9LBZ5 (EMBL:AB033763) (98 aa) fasta scores: E(): 1e-34, 88.77% id in 98 aa, and to Staphylococcus hominis DNA, cassette chromosome scc, DNA sequence : ATGACTTACGAGCAAGAAGATGATTTTAAACTGTTGAAAAGAAGAATTTTAGGAATTGGATTCGTTTTACCGGAGGGACA AGTATTTACTTTCCATGACTTGAACCGTCGTGCAAATGTACAATGCTCAAAAGCTGTACAACAAAATGTTGGACGTTGGT TCGCATATTTTGTTAAAAATGCGCCAAGTGTTCCATTTATTATTATCGGTAAAAATACCAATGGTCATTTAGTATATATG AAAGTCGGACCTAATCCACTCCAAGATAGCAACCCTTCGAAAGGAGGTGTTCGCTAA Protein sequence : MTYEQEDDFKLLKRRILGIGFVLPEGQVFTFHDLNRRANVQCSKAVQQNVGRWFAYFVKNAPSVPFIIIGKNTNGHLVYM KVGPNPLQDSNPSKGGVR |
| Gene | GenBank Accn | Product | Virulance or Resistance | PAI or REI | Alignment Type | E-val | Identity |
| SAS0035 | YP_042168.1 | hypothetical protein | Not tested | SCC476 | Protein | 1e-42 | 100 |
| unnamed | BAA94325.1 | hypothetical protein | Not tested | Type-I SCCmec | Protein | 3e-38 | 89 |
| SACOL0044 | YP_184954.1 | hypothetical protein | Not tested | Type-I SCCmec | Protein | 4e-38 | 89 |
| unnamed | BAB83483.1 | - | Not tested | SCC 12263 | Protein | 2e-36 | 85 |
| SAV0064 | NP_370588.1 | hypothetical protein | Not tested | Type-II SCCmec | Protein | 2e-33 | 77 |
| SA0060 | NP_373300.1 | hypothetical protein | Not tested | Type-II SCCmec | Protein | 2e-33 | 77 |
| unnamed | BAA94655.1 | - | Not tested | Type-II SCCmec | Protein | 2e-33 | 77 |
| SERP2495 | YP_190037.1 | hypothetical protein | Not tested | Type-II SCCmec | Protein | 2e-33 | 77 |
| SAR0062 | YP_039533.1 | hypothetical protein | Not tested | Type-II SCCmec | Protein | 2e-33 | 77 |
| SE0039 | NP_763594.1 | hypothetical protein | Not tested | SCCpbp4 | Protein | 4e-33 | 77 |
| unnamed | BAC67558.1 | hypothetical protein | Not tested | Type-IVc SCCmec | Protein | 6e-33 | 75 |
| SARLGA251_00400 | YP_005754055.1 | hypothetical protein | Not tested | Type-XI SCCmec | Protein | 1e-25 | 59 |
| unnamed | BAB47591.1 | hypothetical protein | Not tested | Type-III SCCmec | Protein | 2e-21 | 53 |
| unnamed | BAB46968.1 | hypothetical protein | Not tested | Type-IIIinv SCCmec | Protein | 2e-21 | 53 |
| SAMSHR1132_00430 | YP_005324566.1 | hypothetical protein | Not tested | Type-IIIinv SCCmec | Protein | 3e-13 | 47 |
| MW0041 | NP_644856.1 | hypothetical protein | Not tested | Type-IV SCCmec | Protein | 3e-13 | 47 |
| SAUSA300_0040 | YP_492760.1 | hypothetical protein | Not tested | Type-IV SCCmec | Protein | 3e-13 | 47 |
| unnamed | BAB72105.1 | hypothetical protein | Not tested | Type-IVa SCCmec | Protein | 8e-13 | 46 |