Gene Information

Name : SERP2467 (SERP2467)
Accession : YP_190010.1
Strain : Staphylococcus epidermidis RP62A
Genome accession: NC_002976
Putative virulence/resistance : Unknown
Product : hypothetical protein
Function : -
COG functional category : S : Function unknown
COG ID : COG4333
EC number : -
Position : 2520514 - 2521017 bp
Length : 504 bp
Strand : +
Note : identified by similarity to OMNI:NTL01SA0058

DNA sequence :
ATGAATACAATAAAAAGTACGACACACACAGAAGCTATATTTAGCGATGATGAACAACACCGCTACTTACTCAAAAAGAC
TTGGAATGAAAAGAAACCCGCATGTACAGTGATAACGATGTATCCTCATTTAGATGGTGTATTATCACTCGATCTTACAA
CTGTTCTCATTCTCAACCAATTAGCGAATTCTGAACAATATGGCGCTGTATATCTTGTAAATCTATTTTCAAATATTAAA
ACTCCAGAAAACCTTAAACATATCAAAGAGCCTTATGACGAGCACACAGATATCCACTTGATGAAAGCGATTAGCGAAAG
TGACACAGTCATTCTAGCCTATGGAGCTTATGCGAAGCGGCCTGTTGTTATTGAACGTGTTGAACAAGTGTTAGAAATGT
TAAAACCTCACAAAAAGAAAGTCAAAAAGCTTATTAATCCAGCAACAAATGAAATCATGCATCCACTTAACCCTAAAGCA
CGTCAAAAATGGACATTGAAATAA

Protein sequence :
MNTIKSTTHTEAIFSDDEQHRYLLKKTWNEKKPACTVITMYPHLDGVLSLDLTTVLILNQLANSEQYGAVYLVNLFSNIK
TPENLKHIKEPYDEHTDIHLMKAISESDTVILAYGAYAKRPVVIERVEQVLEMLKPHKKKVKKLINPATNEIMHPLNPKA
RQKWTLK

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
unnamed BAG06215.2 hypothetical protein Not tested Type-VII SCCmec Protein 4e-68 97
unnamed ACL99847.1 hypothetical protein Not tested Type-V SCCmec Protein 1e-67 96
SAS0029 YP_042162.1 hypothetical protein Not tested SCC476 Protein 2e-67 96
MW0035 NP_644850.1 hypothetical protein Not tested Type-IV SCCmec Protein 6e-67 95
SAUSA300_0036 YP_492756.1 hypothetical protein Not tested Type-IV SCCmec Protein 6e-67 95
SACOL0037 YP_184948.1 hypothetical protein Not tested Type-I SCCmec Protein 3e-67 95
unnamed BAA94663.1 - Not tested Type-II SCCmec Protein 5e-66 95
SAR0056 YP_039527.1 hypothetical protein Not tested Type-II SCCmec Protein 7e-66 95
SERP2504 YP_190046.1 hypothetical protein Not tested Type-II SCCmec Protein 7e-66 95
unnamed BAB72131.1 hypothetical protein Not tested Type-IVb SCCmec Protein 3e-67 95
unnamed BAC67564.1 hypothetical protein Not tested Type-IVc SCCmec Protein 3e-67 95
SAMSHR1132_00360 YP_005324560.1 hypothetical protein Not tested Type-IIIinv SCCmec Protein 5e-67 95
unnamed BAA94331.1 hypothetical protein Not tested Type-I SCCmec Protein 2e-67 95
unnamed BAB72112.1 hypothetical protein Not tested Type-IVa SCCmec Protein 3e-67 95
SE0030 NP_763585.1 hypothetical protein Not tested SCCpbp4 Protein 2e-67 95
SAV0058 NP_370582.1 hypothetical protein Not tested Type-II SCCmec Protein 8e-66 95
SA0054 NP_373294.1 hypothetical protein Not tested Type-II SCCmec Protein 8e-66 95
SAPIG0053 YP_005732863.1 hypothetical protein Not tested Type-V SCCmec Protein 6e-59 95
SH0059 YP_251974.1 hypothetical protein Not tested SCCmec Protein 6e-66 93
unnamed BAD24838.1 hypothetical protein Not tested Type-V SCCmec Protein 2e-67 92
unnamed BAB47669.1 hypothetical protein Not tested Type-III SCCmec Protein 3e-49 70
unnamed BAC53831.1 hypothetical protein Not tested SRImec-III and SCCmec-III region Protein 3e-49 70
unnamed BAB46979.2 hypothetical protein Not tested Type-IIIinv SCCmec Protein 1e-48 69
SAPIG0037 YP_005732847.1 hypothetical protein Not tested Type-V SCCmec Protein 1e-48 69
unnamed ACL99835.1 hypothetical protein Not tested Type-V SCCmec Protein 8e-49 69
unnamed BAG06194.1 hypothetical protein Not tested Type-VII SCCmec Protein 8e-49 69
SARLGA251_00330 YP_005754048.1 hypothetical protein Not tested Type-XI SCCmec Protein 3e-49 68
SSP0031 YP_300121.1 hypothetical protein Not tested SCC15305RM Protein 6e-44 65
SSP0049 YP_300139.1 hypothetical protein Not tested SCC15305cap Protein 6e-43 63
unnamed BAB46974.1 hypothetical protein Not tested Type-IIIinv SCCmec Protein 1e-44 62
unnamed BAB47602.1 hypothetical protein Not tested Type-III SCCmec Protein 1e-44 62