Gene Information

Name : Atu0970 (Atu0970)
Accession : NP_353994.2
Strain :
Genome accession: NC_003062
Putative virulence/resistance : Virulence
Product : two component response regulator
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG0745
EC number : -
Position : 958852 - 959523 bp
Length : 672 bp
Strand : +
Note : -

DNA sequence :
ATGCGTATTCTCGTTGTTGAGGACGATGCCAATCTCAATCGTCAGCTGACCGACGCCCTGAAAGAGGCCGGTTATGTCGT
CGATCAGGCATTCGACGGCGAAGAGGGGCATTACCTCGGCGACACCGAGCCCTATGACGCCATCGTCCTCGATATCGGCC
TGCCGCAACTGGATGGCATTACCGTCGTTGAAAAATGGCGTGCCGCCGGCAAGGCCATGCCGGTCCTCATCCTTACCGCC
CGCGACCGCTGGAGCGACAAGGTGGCGGGCATCGATGCCGGTGCCGATGACTACGTGACCAAGCCTTTCCATGTCGAAGA
AGTGCTTGCCCGCGTGCGCGCGCTCATCCGCCGCGCCGCTGGCCATGCCTCTTCCGAACTGGTCTGCGGCCCGGTCCGGC
TCGACACCAAATCCTCCAAGGCGACCGTCAACGGCACGACGCTGAAACTCACCTCGCATGAGTTCCGGCTCCTGTCCTAT
CTCATGCATCACATGGGCGAGGTCGTTTCGCGCACGGAGCTGGTCGAACATATGTACGATCAGGATTTCGACCGCGATTC
CAACACGATCGAGGTGTTTGTCGGACGTTTGCGCAAGAAGATCGGAGTTGATCTGATCGAGACGATCCGCGGTCTCGGTT
ACCGGATGCAAGCGCCGGCAGATGCGAAGTAA

Protein sequence :
MRILVVEDDANLNRQLTDALKEAGYVVDQAFDGEEGHYLGDTEPYDAIVLDIGLPQLDGITVVEKWRAAGKAMPVLILTA
RDRWSDKVAGIDAGADDYVTKPFHVEEVLARVRALIRRAAGHASSELVCGPVRLDTKSSKATVNGTTLKLTSHEFRLLSY
LMHHMGEVVSRTELVEHMYDQDFDRDSNTIEVFVGRLRKKIGVDLIETIRGLGYRMQAPADAK

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
copR NP_460069.2 transcriptional regulatory protein YedW Not tested SPI-5 Protein 9e-27 42
copR AAC33719.1 regulatory protein CopR Not tested SPI-5 Protein 7e-26 41

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Atu0970 NP_353994.2 two component response regulator NC_002516.2.879194.p Protein 2e-38 47
Atu0970 NP_353994.2 two component response regulator CP000647.1.gene1136. Protein 6e-36 46
Atu0970 NP_353994.2 two component response regulator BAC0530 Protein 5e-36 46
Atu0970 NP_353994.2 two component response regulator CP001918.1.gene2526. Protein 2e-35 45
Atu0970 NP_353994.2 two component response regulator CP001138.1.gene1939. Protein 3e-36 45
Atu0970 NP_353994.2 two component response regulator BAC0111 Protein 5e-32 44
Atu0970 NP_353994.2 two component response regulator NC_002695.1.913289.p Protein 2e-35 44
Atu0970 NP_353994.2 two component response regulator CP004022.1.gene1005. Protein 5e-39 44
Atu0970 NP_353994.2 two component response regulator CP000034.1.gene2022. Protein 4e-36 44
Atu0970 NP_353994.2 two component response regulator BAC0347 Protein 1e-28 43
Atu0970 NP_353994.2 two component response regulator BAC0487 Protein 3e-26 43
Atu0970 NP_353994.2 two component response regulator BAC0197 Protein 6e-30 42
Atu0970 NP_353994.2 two component response regulator BAC0083 Protein 1e-30 41
Atu0970 NP_353994.2 two component response regulator BAC0308 Protein 8e-27 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Atu0970 NP_353994.2 two component response regulator VFG0475 Protein 2e-36 45
Atu0970 NP_353994.2 two component response regulator VFG0596 Protein 3e-27 42
Atu0970 NP_353994.2 two component response regulator VFG1389 Protein 1e-27 42
Atu0970 NP_353994.2 two component response regulator VFG0473 Protein 1e-27 41
Atu0970 NP_353994.2 two component response regulator VFG1390 Protein 3e-27 41