Gene Information

Name : SM_b21084 (SM_b21084)
Accession : NP_437203.1
Strain :
Genome accession: NC_003078
Putative virulence/resistance : Unknown
Product : hypothetical protein
Function : -
COG functional category : L : Replication, recombination and repair
COG ID : COG3436
EC number : -
Position : 722864 - 723217 bp
Length : 354 bp
Strand : +
Note : Product confidence : hypothetical; Gene name confidence : hypothetical

DNA sequence :
ATGATCGTCGCGGGCCAACGACTGCCGATCCTGATTGCAACGCGGCCGGTGGACTTCCGCTGTGGGCATCAGGCGCTGGC
TCTGATGATGCAGACCGAGTTGAAGCTCGACCCGCATTCCGGGGTGACGGTGATCTTCCGGTCGAAGCGCGGTGATCGTC
TGAAAATCCTGGTATGGGATGGCACCGGCATGGTGCTAACCTACAAAATTCTTGAACATGGAAGCTTTGCCTGGCCCAAG
GTGCAGGATGGGACGATGCGTCTTTCCAGGGGGCAATACGAAGCTTTGTTCGAAGGTCTTGATTGGCGACGGGTCATGGC
GCAACGGGTGACCGCGCCGTCGGCGGCAGGGTAA

Protein sequence :
MIVAGQRLPILIATRPVDFRCGHQALALMMQTELKLDPHSGVTVIFRSKRGDRLKILVWDGTGMVLTYKILEHGSFAWPK
VQDGTMRLSRGQYEALFEGLDWRRVMAQRVTAPSAAG

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
Z1132 NP_286667.1 hypothetical protein Not tested TAI Protein 7e-12 47
Z1571 NP_287075.1 hypothetical protein Not tested TAI Protein 7e-12 47
c3578 NP_755453.1 hypothetical protein Not tested PAI I CFT073 Protein 6e-12 47
unnamed AAC31493.1 L0014 Not tested LEE Protein 4e-12 47
Z4336 NP_289561.1 hypothetical protein Not tested OI-122 Protein 6e-12 47
hp4 AAC61716.1 Hp4 Not tested PAI I CFT073 Protein 4e-12 47
Z5097 NP_290248.1 prophage-associated protein Not tested LEE Protein 6e-12 47
unnamed AAL99258.1 unknown Not tested LEE Protein 4e-12 47
ECs4546 NP_312573.1 hypothetical protein Not tested LEE Protein 6e-12 47
unnamed ACU09438.1 IS66 family element orf2 Not tested LEE Protein 4e-12 47
c3561 NP_755436.1 hypothetical protein Not tested PAI I CFT073 Protein 9e-12 47
ECUMN_3327 YP_002414007.1 putative transposase ORF2, IS66 family Not tested Not named Protein 9e-12 47
BCAM0247 YP_002232879.1 putative transposase Not tested BcenGI11 Protein 2e-16 45
unnamed AAL08461.1 unknown Not tested SRL Protein 1e-11 45
pB171ORF50 CAD66190.1 ORF50 protein of pB171 Not tested PAI III 536 Protein 6e-12 44
aec52 AAW51735.1 Aec52 Not tested AGI-3 Protein 5e-12 44
unnamed ADD91739.1 hypothetical protein Not tested PAI-I AL862 Protein 5e-12 44
ECO103_3567 YP_003223430.1 hypothetical protein Not tested LEE Protein 2e-11 43
Z4338 NP_289563.1 hypothetical protein Not tested OI-122 Protein 2e-11 43
Z1160 NP_286695.1 hypothetical protein Not tested TAI Protein 1e-11 42
Z1599 NP_287103.1 hypothetical protein Not tested TAI Protein 1e-11 42
ECUMN_3364 YP_002414037.1 putative transposase ORF2, IS66 family Not tested Not named Protein 1e-11 42

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
SM_b21084 NP_437203.1 hypothetical protein VFG0792 Protein 2e-12 47
SM_b21084 NP_437203.1 hypothetical protein VFG1698 Protein 3e-12 47
SM_b21084 NP_437203.1 hypothetical protein VFG1709 Protein 2e-12 47
SM_b21084 NP_437203.1 hypothetical protein VFG1052 Protein 4e-12 45
SM_b21084 NP_437203.1 hypothetical protein VFG1665 Protein 3e-12 44
SM_b21084 NP_437203.1 hypothetical protein VFG1737 Protein 4e-12 42