Gene Information

Name : transposase_E (spr1298)
Accession : NP_358891.1
Strain : Streptococcus pneumoniae R6
Genome accession: NC_003098
Putative virulence/resistance : Unknown
Product : degenerate transposase
Function : -
COG functional category : L : Replication, recombination and repair
COG ID : COG3436
EC number : -
Position : 1291786 - 1292136 bp
Length : 351 bp
Strand : -
Note : -

DNA sequence :
ATGACAATTCATCTATCTAGCCTAGGGCAGGTCTATCTCGTGTGTGGGAAGACTGATATGAGACAAGGAATCGATTCACT
GGCTTATCTGGTTAAAACCCACTTTGAATTGGATCCTTTCTCCGGTCAAGTTTTTCTCTTTTGTGGTGGACGTAAAGACC
GCTTTAAAGCCCTTTACTGGGATGGTCAAGGATTTTGGCTACTATATAAACGCTTTGAGAACGGCAGACTGACTTGGCCC
AGTACAGAAAAGGATGTCAAAGCTCTCACACCTGAACAAGTAGATTGGCTTATGAAGGGCTTTTCTATCACTCCCAAAAT
AAATTTATCAGAAAGTCGTGATTTCTATTGA

Protein sequence :
MTIHLSSLGQVYLVCGKTDMRQGIDSLAYLVKTHFELDPFSGQVFLFCGGRKDRFKALYWDGQGFWLLYKRFENGRLTWP
STEKDVKALTPEQVDWLMKGFSITPKINLSESRDFY

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
BCAM0247 YP_002232879.1 putative transposase Not tested BcenGI11 Protein 9e-15 47
c3561 NP_755436.1 hypothetical protein Not tested PAI I CFT073 Protein 1e-10 43
ECUMN_3327 YP_002414007.1 putative transposase ORF2, IS66 family Not tested Not named Protein 1e-10 43
unnamed ACU09438.1 IS66 family element orf2 Not tested LEE Protein 4e-10 42
Z5097 NP_290248.1 prophage-associated protein Not tested LEE Protein 6e-10 42
pB171ORF50 CAD66190.1 ORF50 protein of pB171 Not tested PAI III 536 Protein 2e-11 42
ECs4546 NP_312573.1 hypothetical protein Not tested LEE Protein 6e-10 42
aec52 AAW51735.1 Aec52 Not tested AGI-3 Protein 1e-11 42
unnamed ADD91739.1 hypothetical protein Not tested PAI-I AL862 Protein 1e-11 42
unnamed AAC31493.1 L0014 Not tested LEE Protein 4e-10 42
hp4 AAC61716.1 Hp4 Not tested PAI I CFT073 Protein 4e-10 42
c3578 NP_755453.1 hypothetical protein Not tested PAI I CFT073 Protein 6e-10 42
unnamed AAL99258.1 unknown Not tested LEE Protein 4e-10 42
Z4336 NP_289561.1 hypothetical protein Not tested OI-122 Protein 6e-10 42
Z1132 NP_286667.1 hypothetical protein Not tested TAI Protein 4e-09 42
Z1571 NP_287075.1 hypothetical protein Not tested TAI Protein 4e-09 42

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
transposase_E NP_358891.1 degenerate transposase VFG1698 Protein 4e-11 43
transposase_E NP_358891.1 degenerate transposase VFG1709 Protein 2e-10 42
transposase_E NP_358891.1 degenerate transposase VFG1665 Protein 6e-12 42
transposase_E NP_358891.1 degenerate transposase VFG0792 Protein 2e-10 42