Gene Information

Name : smrA (SAV_3352)
Accession : NP_824528.1
Strain : Streptomyces avermitilis MA-4680
Genome accession: NC_003155
Putative virulence/resistance : Virulence
Product : two-component system response regulator
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG0745
EC number : -
Position : 4168730 - 4169407 bp
Length : 678 bp
Strand : +
Note : PF00072: Response regulator receiver domain

DNA sequence :
GTGCCTTCCCTGTTGCTGATCGAGGACGACGACGCCATCCGTACGGCCCTGGAGCTCTCTTTGACTCGCCAGGGACACCG
TGTGGCCACCGCTGCCACCGGCGAGGACGGTTTGAAGCTGCTGCGCGAGCAACGGCCGGACCTGATCGTGCTGGACGTGA
TGCTGCCGGGCATCGACGGGTTCGAGGTGTGCCGGCGCATCCGGCGCACGGACCAGCTGCCGATCATTCTGCTGACCGCG
CGCAACGATGACATCGATGTGGTGGTCGGGCTGGAGTCCGGCGCCGACGACTATGTCGTGAAGCCCGTGCAGGGGCGGGT
GCTCGACGCCCGGATCCGGGCCGTGCTGCGGCGCGGCGAGCGCGAGGCCAACGACTCGGCGACCTTCGGGTCCCTGGTCA
TCGACCGGGCGGCCATGACGGTCACCAAGAACGGCGAGGACCTGCAACTGACGCCGACCGAGCTGCGGTTGCTCCTCGAA
CTGAGCAGGCGGCCCGGCCAGGCGCTGTCCCGTCAGCAGCTGCTGCGGCTCGTCTGGGAGCACGACTACCTCGGCGACTC
ACGGCTCGTGGACGCGTGTGTGCAGCGGCTGCGGGCCAAGGTCGAGGACGTTCCCTCCTCCCCCACGCTCATCCGTACCG
TGCGCGGGGTCGGCTACCGGCTGGACTCTCCTCAGTGA

Protein sequence :
MPSLLLIEDDDAIRTALELSLTRQGHRVATAATGEDGLKLLREQRPDLIVLDVMLPGIDGFEVCRRIRRTDQLPIILLTA
RNDDIDVVVGLESGADDYVVKPVQGRVLDARIRAVLRRGEREANDSATFGSLVIDRAAMTVTKNGEDLQLTPTELRLLLE
LSRRPGQALSRQQLLRLVWEHDYLGDSRLVDACVQRLRAKVEDVPSSPTLIRTVRGVGYRLDSPQ

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
copR NP_460069.2 transcriptional regulatory protein YedW Not tested SPI-5 Protein 7e-24 42

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
smrA NP_824528.1 two-component system response regulator AE000516.2.gene3505. Protein 1e-34 47
smrA NP_824528.1 two-component system response regulator NC_002952.2859905.p0 Protein 4e-38 44
smrA NP_824528.1 two-component system response regulator NC_009782.5559369.p0 Protein 5e-38 44
smrA NP_824528.1 two-component system response regulator NC_002951.3237708.p0 Protein 5e-38 44
smrA NP_824528.1 two-component system response regulator NC_003923.1003749.p0 Protein 4e-38 44
smrA NP_824528.1 two-component system response regulator NC_002758.1121668.p0 Protein 5e-38 44
smrA NP_824528.1 two-component system response regulator NC_007622.3794472.p0 Protein 3e-38 44
smrA NP_824528.1 two-component system response regulator NC_009641.5332272.p0 Protein 5e-38 44
smrA NP_824528.1 two-component system response regulator NC_013450.8614421.p0 Protein 5e-38 44
smrA NP_824528.1 two-component system response regulator NC_007793.3914279.p0 Protein 5e-38 44
smrA NP_824528.1 two-component system response regulator NC_002745.1124361.p0 Protein 5e-38 44
smrA NP_824528.1 two-component system response regulator NC_012469.1.7685629. Protein 8e-40 43
smrA NP_824528.1 two-component system response regulator NC_002952.2859858.p0 Protein 4e-32 42
smrA NP_824528.1 two-component system response regulator NC_007622.3794948.p0 Protein 4e-32 42
smrA NP_824528.1 two-component system response regulator NC_003923.1003417.p0 Protein 4e-32 42
smrA NP_824528.1 two-component system response regulator NC_013450.8614146.p0 Protein 4e-32 42
smrA NP_824528.1 two-component system response regulator NC_002951.3238224.p0 Protein 4e-32 42
smrA NP_824528.1 two-component system response regulator NC_007793.3914065.p0 Protein 4e-32 42
smrA NP_824528.1 two-component system response regulator NC_002758.1121390.p0 Protein 4e-32 42
smrA NP_824528.1 two-component system response regulator NC_010079.5776364.p0 Protein 4e-32 42
smrA NP_824528.1 two-component system response regulator BAC0197 Protein 4e-26 42
smrA NP_824528.1 two-component system response regulator BAC0125 Protein 2e-24 41
smrA NP_824528.1 two-component system response regulator NC_012469.1.7686381. Protein 4e-33 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
smrA NP_824528.1 two-component system response regulator VFG0596 Protein 3e-24 42
smrA NP_824528.1 two-component system response regulator VFG1389 Protein 7e-23 42
smrA NP_824528.1 two-component system response regulator VFG1390 Protein 1e-27 41