Gene Information

Name : terD4 (SAV_5804)
Accession : NP_826981.1
Strain : Streptomyces avermitilis MA-4680
Genome accession: NC_003155
Putative virulence/resistance : Resistance
Product : tellurium resistance protein
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG2310
EC number : -
Position : 7009785 - 7010360 bp
Length : 576 bp
Strand : +
Note : PF02342: Bacterial stress protein

DNA sequence :
ATGGGCGTCACGCTCGCCAAGGGAGGCAATGTCTCCCTGTCCAAGGCCGCGCCGAACCTCACGCAGGTGATGATCGGCCT
CGGCTGGGACGCGCGCTCCACCACCGGAGCCCCCTTCGACCTCGACGCCAGCGCGCTGCTGTGCCGTGAGGGCCGGGTGC
TGGGCGACGAGTGGTTCGTCTTCTACAACCAGCTCAAGAGCCCGGACGGCTCGGTGGAGCACACCGGCGACAACCTCACG
GGTGAGGGCGAGGGCGACGACGAGTCGATCCTGGTCGACCTCTCCACGGTGCCGGCCCAGGTCGACAAGATCGTCTTCCC
TGTCTCGATCCACGAGGCGGACAACCGCGGACAGACCTTCGGACAGGTCAGCAACGCGTTCATCCGCGTGGTCAACCAGG
CCGACGGCCAGGAGCTGGCCCGCTACGACCTGAGCGAGGACGCCTCGACGGAGACCGCAATGATCTTCGGCGAGGTCTAC
CGATACGGAGGCGAATGGAAGTTCCGCGCGGTGGGACAGGGGTACGCATCCGGACTGCGGGGCATCGTTCAAGACTTCGG
GGTCAGCGTCTCCTAG

Protein sequence :
MGVTLAKGGNVSLSKAAPNLTQVMIGLGWDARSTTGAPFDLDASALLCREGRVLGDEWFVFYNQLKSPDGSVEHTGDNLT
GEGEGDDESILVDLSTVPAQVDKIVFPVSIHEADNRGQTFGQVSNAFIRVVNQADGQELARYDLSEDASTETAMIFGEVY
RYGGEWKFRAVGQGYASGLRGIVQDFGVSVS

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
terD NP_286710.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 7e-58 66
terD_2 NP_287118.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 7e-58 66
unnamed ACY75542.1 tellurium-resistance protein Not tested Tn6060 Protein 2e-60 66
tlrC AAF36435.1 putative tellurium resistance protein C Not tested TAI Protein 2e-57 65
unnamed ACY75541.1 tellurium-resistance protein Not tested Tn6060 Protein 8e-55 60
tlrB AAF36434.1 putative tellurium resistance protein B Not tested TAI Protein 3e-53 59
terE NP_286711.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 4e-53 59
terE_2 NP_287119.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 4e-53 59
terZ ACY75546.1 tellurite resistance protein TerZ Not tested Tn6060 Protein 3e-28 44
terZ NP_286706.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 2e-26 43
terZ_2 NP_287114.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 2e-26 43

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
terD4 NP_826981.1 tellurium resistance protein BAC0389 Protein 2e-57 65
terD4 NP_826981.1 tellurium resistance protein BAC0390 Protein 9e-57 62
terD4 NP_826981.1 tellurium resistance protein BAC0392 Protein 4e-26 43