Gene Information

Name : terD1 (SAV_896)
Accession : NP_822071.1
Strain : Streptomyces avermitilis MA-4680
Genome accession: NC_003155
Putative virulence/resistance : Resistance
Product : tellurium resistance protein
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG2310
EC number : -
Position : 1074296 - 1074871 bp
Length : 576 bp
Strand : +
Note : PF02342: Bacterial stress protein

DNA sequence :
GTGGGAGTTTCCCTGTCCAAAGGCGGCAATGTCTCGCTCAGCAAGGAGGCGCCGGGCCTGACCGCGGTCCTCGTCGGCCT
GGGCTGGGACGTGCGGACCACCACGGGCACCGACTACGACCTCGACGCGTCCGCGCTGCTGGTCGACACCTCCGGCAAGG
TCCTCTCCGACCAGCACTTCATCTTCTACAACAACCTGAAGAGCCCGGACGGCTCGGTGGAGCACACCGGCGACAACCTC
ACCGGTGAGGGCGAGGGCGACGACGAGTCCGTCAAGGTGAACCTCGCCGCCGTGCCCGCCGAGGTCGACAAGATCGTCTT
CCCGGTCTCGATTCACGACGCCGAGAGCCGCGGTCAGAGTTTCGGCCAGGTCCGCAACGCCTTCATCCGCGTCGTCAACC
AGGCGGGCGGTCAGGAGATCGCGCGGTACGACCTGTCCGAGGACGCCTCGACCGAAACCGCGATGGTCTTCGGGGAGCTG
TACCGGAACGGCGCCGATTGGAAGTTCCGCGCCGTCGGCCAGGGCTACGCGTCGGGCCTGTCCGGCATCGCCTCCGACTT
CGGCGTCAACGTCTGA

Protein sequence :
MGVSLSKGGNVSLSKEAPGLTAVLVGLGWDVRTTTGTDYDLDASALLVDTSGKVLSDQHFIFYNNLKSPDGSVEHTGDNL
TGEGEGDDESVKVNLAAVPAEVDKIVFPVSIHDAESRGQSFGQVRNAFIRVVNQAGGQEIARYDLSEDASTETAMVFGEL
YRNGADWKFRAVGQGYASGLSGIASDFGVNV

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
unnamed ACY75542.1 tellurium-resistance protein Not tested Tn6060 Protein 1e-64 69
terD NP_286710.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 3e-63 69
terD_2 NP_287118.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 3e-63 69
tlrC AAF36435.1 putative tellurium resistance protein C Not tested TAI Protein 8e-63 68
terE NP_286711.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 3e-59 66
terE_2 NP_287119.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 3e-59 66
tlrB AAF36434.1 putative tellurium resistance protein B Not tested TAI Protein 2e-59 66
unnamed ACY75541.1 tellurium-resistance protein Not tested Tn6060 Protein 3e-58 65
terZ NP_286706.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 2e-29 45
terZ_2 NP_287114.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 2e-29 45
terZ ACY75546.1 tellurite resistance protein TerZ Not tested Tn6060 Protein 3e-31 44

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
terD1 NP_822071.1 tellurium resistance protein BAC0389 Protein 7e-63 68
terD1 NP_822071.1 tellurium resistance protein BAC0390 Protein 2e-63 66
terD1 NP_822071.1 tellurium resistance protein BAC0392 Protein 1e-28 44