Name : STY2885 Accession : NP_457168.1 Strain : Salmonella enterica CT18 Genome accession: NC_003198 Putative virulence/resistance : Unknown Product : putative bacteriophage protein Function : - COG functional category : - COG ID : - EC number : - Position : 2765868 - 2765987 bp Length : 120 bp Strand : - Note : Similar to part of hypothetical bacteriophage proteins e.g. Bacteriophage 186 ORF52 H TR:O80316 (EMBL:U32222) (58 aa) fasta scores: E(): 1.1e-08, 59.0% id in 39 aa and Bacteriophage P2 GPE+E' TR:O64312 (EMBL:AF063097) (142 aa) fasta scores: E(): 7.5e-08, DNA sequence : GTGGCAGATATCGCCACCATTTTTCACTGGCCGCCATCCGTTACTGACGTTATGCCGCTGACCGAAGTGCTGGAATGGCG GTATAAAGCGATTCAGAGAAGCGGGGCCAACGATGAGTGA Protein sequence : MADIATIFHWPPSVTDVMPLTEVLEWRYKAIQRSGANDE |
Gene | GenBank Accn | Product | Virulance or Resistance | PAI or REI | Alignment Type | E-val | Identity |
t4298 | NP_807895.1 | hypothetical protein | Not tested | SPI-7 | Protein | 2e-11 | 88 |
STY4604 | NP_458687.1 | hypothetical protein | Not tested | SPI-7 | Protein | 2e-11 | 88 |
unnamed | ABR13487.1 | hypothetical protein | Not tested | PAGI-6 | Protein | 7e-05 | 52 |