Gene Information

Name : BF2241 (BF2241)
Accession : YP_211864.1
Strain : Bacteroides fragilis NCTC 9343
Genome accession: NC_003228
Putative virulence/resistance : Virulence
Product : two component system response regulator
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG0745
EC number : -
Position : 2619192 - 2619866 bp
Length : 675 bp
Strand : +
Note : Similar to Escherichia coli, Escherichia coli O6, and Escherichia coli O157:H7 transcriptional regulatory protein CusR or B0571 or C0657 or Z0709 or ECS0609 SWALL:CUSR_ECOLI (SWALL:P77380) (227 aa) fasta scores: E(): 4.8e-35, 46.15% id in 221 aa, and to B

DNA sequence :
ATGGCTAAGATATTATTGGTAGAAGATGAAGTGAATATAGCTTCGTTTATAGAACGGGGTTTGAAGGAGTTTGGACATTC
TGTGTCGGTGGCTAATGACGGTGATGCCGGATGGGAACTCATCCGGCAAGAAGCATTCGACCTGTTGATCCTGGATATTA
TCATGCCTAAGATGAACGGTCTGGAGCTATGCCGGCTTTATCGGCAGCAATACGGTTATCTCACCCCGGTTATAATGTTG
ACTGCATTGGGCACCACGGAGGATATCGTGAAAGGGCTCGATTCGGGGGCGGATGACTATTTGGTGAAACCATTCAGCTT
TCAGGAACTGGAGGCGCGCATCAAGGCCATCCTGCGCAGAGGGCGGGAAGACTCTGTCCAGCAGCTGGTATGTGATGATC
TGGTGCTTAACTGCAACACCCGCCGTGCCAGACGCAAGGAGGTGGAGATAGAACTCACTGTTAAGGAGTACCGCTTGCTG
GAGTATTTCATGACCCATCAAGGCATGGTGCTTTCGCGCCTGACATTATTGAAAGATGTATGGGATAAGAATTTCGATAC
GAATACCAATGTGGTAGATGTTTATGTGAACTATCTTCGTGGTAAAATAGATAAGGAGCATGACAAGAAATTGATTCATA
CGGTGGTAGGTTCGGGATATATCATGTATGCTTAA

Protein sequence :
MAKILLVEDEVNIASFIERGLKEFGHSVSVANDGDAGWELIRQEAFDLLILDIIMPKMNGLELCRLYRQQYGYLTPVIML
TALGTTEDIVKGLDSGADDYLVKPFSFQELEARIKAILRRGREDSVQQLVCDDLVLNCNTRRARRKEVEIELTVKEYRLL
EYFMTHQGMVLSRLTLLKDVWDKNFDTNTNVVDVYVNYLRGKIDKEHDKKLIHTVVGSGYIMYA

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
copR NP_460069.2 transcriptional regulatory protein YedW Not tested SPI-5 Protein 7e-27 43
copR AAC33719.1 regulatory protein CopR Not tested SPI-5 Protein 7e-26 41

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
BF2241 YP_211864.1 two component system response regulator HE999704.1.gene1528. Protein 4e-27 47
BF2241 YP_211864.1 two component system response regulator BAC0111 Protein 2e-39 47
BF2241 YP_211864.1 two component system response regulator BAC0083 Protein 3e-31 46
BF2241 YP_211864.1 two component system response regulator BAC0125 Protein 1e-33 45
BF2241 YP_211864.1 two component system response regulator BAC0347 Protein 2e-35 45
BF2241 YP_211864.1 two component system response regulator NC_010079.5776364.p0 Protein 1e-27 44
BF2241 YP_211864.1 two component system response regulator NC_002952.2859858.p0 Protein 1e-27 44
BF2241 YP_211864.1 two component system response regulator NC_007622.3794948.p0 Protein 1e-27 44
BF2241 YP_211864.1 two component system response regulator NC_003923.1003417.p0 Protein 1e-27 44
BF2241 YP_211864.1 two component system response regulator NC_013450.8614146.p0 Protein 1e-27 44
BF2241 YP_211864.1 two component system response regulator NC_002951.3238224.p0 Protein 1e-27 44
BF2241 YP_211864.1 two component system response regulator NC_007793.3914065.p0 Protein 1e-27 44
BF2241 YP_211864.1 two component system response regulator NC_002758.1121390.p0 Protein 1e-27 44
BF2241 YP_211864.1 two component system response regulator BAC0197 Protein 8e-31 44
BF2241 YP_211864.1 two component system response regulator AE015929.1.gene1106. Protein 3e-24 43
BF2241 YP_211864.1 two component system response regulator BAC0638 Protein 7e-25 43
BF2241 YP_211864.1 two component system response regulator BAC0308 Protein 1e-30 42

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
BF2241 YP_211864.1 two component system response regulator VFG0596 Protein 2e-27 43