Gene Information

Name : RSc2314 (RSc2314)
Accession : NP_520435.1
Strain : Ralstonia solanacearum GMI1000
Genome accession: NC_003295
Putative virulence/resistance : Unknown
Product : transposase
Function : -
COG functional category : L : Replication, recombination and repair
COG ID : COG2963
EC number : -
Position : 2515076 - 2515384 bp
Length : 309 bp
Strand : -
Note : -

DNA sequence :
ATGGTCAAGCAACGACGTTCGTTTTCCCCCGAGTTCAAGCAGCAGGCTGCCTGCCTGGTTCTCGACCAGTGCTACAGCCA
TATCGAAGCGAGTCGCTCGGTCGGCGTCGCCGAGTCGGTGCTGCGTCGCTGGGTGCAGCAGCTTCAGATGGAACGCCAGG
GCATCACGCCGCGAGGCTTGGCCATGACGCCGGATCAGCAGCATATCCAGGAGCTTGAAGCGCGCATTGAGCGCCTCGAG
CGCGAGAAGGCCATTTTAAAAAAGGCTACCGCGCTCTTGATGTCGGAAGGCATCGAACGTACGAGGTAA

Protein sequence :
MVKQRRSFSPEFKQQAACLVLDQCYSHIEASRSVGVAESVLRRWVQQLQMERQGITPRGLAMTPDQQHIQELEARIERLE
REKAILKKATALLMSEGIERTR

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
RS05 AAP82950.1 putative transposase Not tested PAPI-2 Protein 4e-24 73
unnamed CAD42034.1 hypothetical protein Not tested PAI II 536 Protein 3e-17 54
orfA ACX47959.1 IS1359 transposase; OrfA Not tested SGI1 Protein 4e-15 52
VPI2_0009c ACA01826.1 transposase OrfAB subunit A Not tested VPI-2 Protein 4e-15 52
VC1790 NP_231425.1 transposase OrfAB subunit A Not tested VPI-2 Protein 5e-15 52
orfA AGK06911.1 IS1359 transposase; OrfA Not tested SGI1 Protein 4e-15 52
orfA YP_001217330.1 transposase OrfAB subunit A Not tested VPI-2 Protein 5e-15 52
unnamed AGK06948.1 IS1359 transposase; OrfA Not tested SGI1 Protein 4e-15 52
orfA AGK06994.1 IS1359 transposase; OrfA Not tested SGI1 Protein 4e-15 52
orfA AGK07052.1 IS1359 transposase; OrfA Not tested SGI1 Protein 4e-15 52
ECO111_3778 YP_003236113.1 putative IS602 transposase OrfA Not tested LEE Protein 3e-14 50
aec66 AAW51749.1 Aec66 Not tested AGI-3 Protein 2e-14 50
unnamed ACU09431.1 IS911 transposase orfA Not tested LEE Protein 6e-13 49
unnamed AAC31483.1 L0004 Not tested LEE Protein 5e-13 49
Z5088 NP_290240.1 hypothetical protein Not tested LEE Protein 8e-13 49
ECs4535 NP_312562.1 hypothetical protein Not tested LEE Protein 8e-13 49
l7045 CAD33744.1 - Not tested PAI I 536 Protein 5e-15 47
orfA CAE85179.1 OrfA protein, IS911 Not tested PAI V 536 Protein 5e-15 47
insN YP_002152325.1 transposase for insertion sequence element IS911 Not tested Not named Protein 7e-14 46

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
RSc2314 NP_520435.1 transposase VFG1553 Protein 1e-17 54
RSc2314 NP_520435.1 transposase VFG1123 Protein 2e-15 52
RSc2314 NP_520435.1 transposase VFG0784 Protein 2e-13 49
RSc2314 NP_520435.1 transposase VFG1485 Protein 2e-15 47