Gene Information

Name : RSp1042 (RS02379)
Accession : NP_522603.1
Strain :
Genome accession: NC_003296
Putative virulence/resistance : Virulence
Product : two-component response regulator transcription regulator protein
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG0745
EC number : -
Position : 1320253 - 1320936 bp
Length : 684 bp
Strand : +
Note : -

DNA sequence :
ATGCACATCCTCCTAATAGAAGACGATCAGAAAGCGGCCCGCCTGCTGGCCAGGGGCTTGCAGGAGGAAGGCTTCGAGGT
GGCGGTCGCGCATTCCGCGGAAGAGGCCGATGCCTCGCTTCTGGTGGCATGCCAGCTGATCATCCTGGATTGGATGCTCC
CGGGCAAGGACGGCATCGCCCTGTGCCGCGAGCTGCGCGAGCGCGATCTCCAGACCCCCGTCCTCATGCTGACCGCCCGC
GACGCGACCGCCGATCGCATCGCCGGCCTGGATACCGGCGCCGACGACTACCTGACCAAGCCCTTCGTCTTCGATGAGTT
GCTCGCCCGCGTCCGCGCGCTGTTGCGGCGGGCCCGGCTGGCGCCCGCCGCGCCGCGGGTCATCGGCGACCTCGTGCTCG
ATCCGAACGCGCGGGCGGTGACGCGCGGCGGCCAGGCGCTCGATGTCACGCCCAAGGAATACGCGATCCTCGAATATCTG
ATGCGGCATGCCGGGCAGATCGTCAGCCGCCTGCAGCTGGCCGAGCACGTCTGGCGCGCCGACCTGATCGCGATCGACAA
CCTCATCGACGTGCACATGAAGAACCTGCGCCGCAAGGTCGATCCGCCCGGCCAGCCGGCCCTCATCCATACGGTGCGGG
GCCAGGGCTTTCGCCTCGCGGCGCCGGAGCGCCGGCATGCTTAG

Protein sequence :
MHILLIEDDQKAARLLARGLQEEGFEVAVAHSAEEADASLLVACQLIILDWMLPGKDGIALCRELRERDLQTPVLMLTAR
DATADRIAGLDTGADDYLTKPFVFDELLARVRALLRRARLAPAAPRVIGDLVLDPNARAVTRGGQALDVTPKEYAILEYL
MRHAGQIVSRLQLAEHVWRADLIAIDNLIDVHMKNLRRKVDPPGQPALIHTVRGQGFRLAAPERRHA

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
copR NP_460069.2 transcriptional regulatory protein YedW Not tested SPI-5 Protein 8e-29 44
copR AAC33719.1 regulatory protein CopR Not tested SPI-5 Protein 3e-28 43

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
RSp1042 NP_522603.1 two-component response regulator transcription regulator protein BAC0197 Protein 2e-31 45
RSp1042 NP_522603.1 two-component response regulator transcription regulator protein BAC0083 Protein 1e-32 44
RSp1042 NP_522603.1 two-component response regulator transcription regulator protein CP000675.2.gene1535. Protein 3e-25 44
RSp1042 NP_522603.1 two-component response regulator transcription regulator protein BAC0308 Protein 4e-33 44
RSp1042 NP_522603.1 two-component response regulator transcription regulator protein BAC0125 Protein 2e-33 43
RSp1042 NP_522603.1 two-component response regulator transcription regulator protein BAC0111 Protein 2e-34 42
RSp1042 NP_522603.1 two-component response regulator transcription regulator protein AE000516.2.gene3505. Protein 2e-28 42
RSp1042 NP_522603.1 two-component response regulator transcription regulator protein BAC0487 Protein 4e-20 41
RSp1042 NP_522603.1 two-component response regulator transcription regulator protein BAC0638 Protein 5e-24 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
RSp1042 NP_522603.1 two-component response regulator transcription regulator protein VFG0596 Protein 3e-29 44
RSp1042 NP_522603.1 two-component response regulator transcription regulator protein VFG0473 Protein 3e-23 43
RSp1042 NP_522603.1 two-component response regulator transcription regulator protein VFG1390 Protein 1e-31 41
RSp1042 NP_522603.1 two-component response regulator transcription regulator protein VFG1389 Protein 7e-25 41