Gene Information

Name : czcR (RSp0489)
Accession : NP_522050.1
Strain :
Genome accession: NC_003296
Putative virulence/resistance : Virulence
Product : response regulator for cobalt zinc cadmium resistance transcription regulator protein
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG0745
EC number : -
Position : 611145 - 611819 bp
Length : 675 bp
Strand : -
Note : Product confidence : probable; Gene name confidence : probable; predicted by Codon_usage; predicted by Homology; predicted by FrameD

DNA sequence :
ATGCGACTGCTCATCGTCGAAGACGAGCCCAAGGCGGGCGACTATCTCCTGAAGGGCCTGACGGAATCCGGCTTCGTGGC
CGACCTCGCCCGCTCCGGCCCCGATGGCCTCTACCAGGCCATGGAACACGACTACGACCTGATCGTGCTCGACGTCATGC
TGCCCGGCATGGACGGCTGGCAGGTCATCCGCGAACTGCGCCGCCGCAAGACCACGCCGGTGCTCTTCCTCACCGCCCGC
GACGAGCTGTCCGACCGCCTGAAGGGCCTGGAGCTGGGCGCCGACGATTACCTCGTCAAGCCCTTCGCCTTTGCCGAGCT
GGTGGCGCGCGTGCACACCATCCTGCGGCGCGGGCCGATGCGCGAGAGCGAGGTCCTCGAAATCGCCGACCTGACCATCG
ACACCATCAAGCGCCGCGTCACGCGCGCCGGCCGCAGGATCGACCTGACTGCCAAGGAATACGCCCTGCTGCACCTGCTG
GCGCGCCGCACGGGCGAGGTGCTGTCGCGCTCGCTGATCTCCTCGCAGGTGTGGGACGTGAACTTCGACAGCAACACCAA
CGTGGTCGACGTCGCCATCCGCCGCCTGCGCGCCAAGGTGGACGACCCGTTCGAACACAAACTGATCCACACGCTGCGCG
GCATGGGCTACGTGCTGGACACGGTGGCCCGATGA

Protein sequence :
MRLLIVEDEPKAGDYLLKGLTESGFVADLARSGPDGLYQAMEHDYDLIVLDVMLPGMDGWQVIRELRRRKTTPVLFLTAR
DELSDRLKGLELGADDYLVKPFAFAELVARVHTILRRGPMRESEVLEIADLTIDTIKRRVTRAGRRIDLTAKEYALLHLL
ARRTGEVLSRSLISSQVWDVNFDSNTNVVDVAIRRLRAKVDDPFEHKLIHTLRGMGYVLDTVAR

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
copR NP_460069.2 transcriptional regulatory protein YedW Not tested SPI-5 Protein 3e-59 57
copR AAC33719.1 regulatory protein CopR Not tested SPI-5 Protein 2e-58 55

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
czcR NP_522050.1 response regulator for cobalt zinc cadmium resistance transcription regulator protein BAC0125 Protein 2e-73 68
czcR NP_522050.1 response regulator for cobalt zinc cadmium resistance transcription regulator protein BAC0197 Protein 1e-70 68
czcR NP_522050.1 response regulator for cobalt zinc cadmium resistance transcription regulator protein BAC0083 Protein 3e-68 65
czcR NP_522050.1 response regulator for cobalt zinc cadmium resistance transcription regulator protein BAC0638 Protein 6e-61 65
czcR NP_522050.1 response regulator for cobalt zinc cadmium resistance transcription regulator protein BAC0308 Protein 2e-65 63
czcR NP_522050.1 response regulator for cobalt zinc cadmium resistance transcription regulator protein BAC0111 Protein 6e-65 61
czcR NP_522050.1 response regulator for cobalt zinc cadmium resistance transcription regulator protein BAC0347 Protein 2e-57 56
czcR NP_522050.1 response regulator for cobalt zinc cadmium resistance transcription regulator protein NC_010079.5776364.p0 Protein 4e-42 44
czcR NP_522050.1 response regulator for cobalt zinc cadmium resistance transcription regulator protein NC_002952.2859858.p0 Protein 4e-42 44
czcR NP_522050.1 response regulator for cobalt zinc cadmium resistance transcription regulator protein NC_007622.3794948.p0 Protein 4e-42 44
czcR NP_522050.1 response regulator for cobalt zinc cadmium resistance transcription regulator protein NC_003923.1003417.p0 Protein 4e-42 44
czcR NP_522050.1 response regulator for cobalt zinc cadmium resistance transcription regulator protein NC_013450.8614146.p0 Protein 4e-42 44
czcR NP_522050.1 response regulator for cobalt zinc cadmium resistance transcription regulator protein NC_002951.3238224.p0 Protein 4e-42 44
czcR NP_522050.1 response regulator for cobalt zinc cadmium resistance transcription regulator protein NC_007793.3914065.p0 Protein 4e-42 44
czcR NP_522050.1 response regulator for cobalt zinc cadmium resistance transcription regulator protein NC_002758.1121390.p0 Protein 4e-42 44
czcR NP_522050.1 response regulator for cobalt zinc cadmium resistance transcription regulator protein AE015929.1.gene1106. Protein 1e-36 43
czcR NP_522050.1 response regulator for cobalt zinc cadmium resistance transcription regulator protein AE000516.2.gene3505. Protein 5e-31 42
czcR NP_522050.1 response regulator for cobalt zinc cadmium resistance transcription regulator protein NC_002952.2859905.p0 Protein 3e-32 41
czcR NP_522050.1 response regulator for cobalt zinc cadmium resistance transcription regulator protein NC_009782.5559369.p0 Protein 4e-32 41
czcR NP_522050.1 response regulator for cobalt zinc cadmium resistance transcription regulator protein NC_002951.3237708.p0 Protein 4e-32 41
czcR NP_522050.1 response regulator for cobalt zinc cadmium resistance transcription regulator protein NC_002758.1121668.p0 Protein 4e-32 41
czcR NP_522050.1 response regulator for cobalt zinc cadmium resistance transcription regulator protein NC_009641.5332272.p0 Protein 4e-32 41
czcR NP_522050.1 response regulator for cobalt zinc cadmium resistance transcription regulator protein NC_013450.8614421.p0 Protein 4e-32 41
czcR NP_522050.1 response regulator for cobalt zinc cadmium resistance transcription regulator protein NC_007793.3914279.p0 Protein 4e-32 41
czcR NP_522050.1 response regulator for cobalt zinc cadmium resistance transcription regulator protein NC_003923.1003749.p0 Protein 5e-32 41
czcR NP_522050.1 response regulator for cobalt zinc cadmium resistance transcription regulator protein NC_007622.3794472.p0 Protein 3e-32 41
czcR NP_522050.1 response regulator for cobalt zinc cadmium resistance transcription regulator protein NC_002745.1124361.p0 Protein 4e-32 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
czcR NP_522050.1 response regulator for cobalt zinc cadmium resistance transcription regulator protein VFG0596 Protein 9e-60 57
czcR NP_522050.1 response regulator for cobalt zinc cadmium resistance transcription regulator protein VFG1389 Protein 1e-32 45
czcR NP_522050.1 response regulator for cobalt zinc cadmium resistance transcription regulator protein VFG1390 Protein 6e-38 43
czcR NP_522050.1 response regulator for cobalt zinc cadmium resistance transcription regulator protein VFG1386 Protein 7e-36 43