Gene Information

Name : Cgl0754 (NCgl0721)
Accession : NP_599983.1
Strain : Corynebacterium glutamicum ATCC 13032
Genome accession: NC_003450
Putative virulence/resistance : Virulence
Product : two-component system response regulator
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG0745
EC number : -
Position : 790732 - 791412 bp
Length : 681 bp
Strand : +
Note : contains a CheY-like receiver domain and a HTH DNA-binding domain

DNA sequence :
ATGTCACAGAAAATTCTCGTGGTTGATGATGATCCCGCCATCTCCGAGATGCTCACCATCGTGCTCAGCGCAGAAGGCTT
TGACACCGTAGCTGTCACCGACGGCGCACTCGCCGTGGAAACCGCCTCCCGGGAACAACCGGATCTGATTTTGCTCGACT
TGATGCTTCCAGGCATGAACGGCATCGACATTTGTCGCCTCATCCGCCAAGAATCCTCCGTACCCATCATCATGCTCACC
GCCAAAACCGACACCGTTGATGTGGTGCTCGGTTTGGAATCCGGTGCAGACGATTACGTGAACAAGCCTTTCAAAGCGAA
AGAACTTGTCGCCCGCATCCGTGCCCGCCTCCGCGCAACCGTGGACGAGCCCAGCGAAATCATCGAAGTCGGCGATCTGT
CCATCGACGTCCCAGCACACACCGTCAAACGAAACGGCGCTGAGATTTCCTTGACCCCACTCGAATTCGACCTCCTGCTG
GAACTCGCCCGCAAACCACAGCAAGTATTCACCCGTGAAGAATTGCTGGGCAAAGTGTGGGGCTACCGCCACGCATCCGA
CACTCGACTGGTCAACGTTCACGTTCAGCGTCTGCGCGCCAAGATTGAAAAAGATCCAGAAAATCCGCAGATCGTCCTCA
CCGTCCGCGGTGTTGGCTACAAAACTGGCCACAACGATTAA

Protein sequence :
MSQKILVVDDDPAISEMLTIVLSAEGFDTVAVTDGALAVETASREQPDLILLDLMLPGMNGIDICRLIRQESSVPIIMLT
AKTDTVDVVLGLESGADDYVNKPFKAKELVARIRARLRATVDEPSEIIEVGDLSIDVPAHTVKRNGAEISLTPLEFDLLL
ELARKPQQVFTREELLGKVWGYRHASDTRLVNVHVQRLRAKIEKDPENPQIVLTVRGVGYKTGHND

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
unnamed CAD42044.1 hypothetical protein Not tested PAI II 536 Protein 1e-36 43
c3565 NP_755440.1 response regulator Not tested PAI I CFT073 Protein 1e-36 43

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Cgl0754 NP_599983.1 two-component system response regulator AE000516.2.gene3505. Protein 9e-69 73
Cgl0754 NP_599983.1 two-component system response regulator NC_002952.2859905.p0 Protein 3e-43 48
Cgl0754 NP_599983.1 two-component system response regulator NC_002758.1121668.p0 Protein 4e-43 48
Cgl0754 NP_599983.1 two-component system response regulator NC_003923.1003749.p0 Protein 3e-43 48
Cgl0754 NP_599983.1 two-component system response regulator NC_009641.5332272.p0 Protein 4e-43 48
Cgl0754 NP_599983.1 two-component system response regulator NC_013450.8614421.p0 Protein 4e-43 48
Cgl0754 NP_599983.1 two-component system response regulator NC_007793.3914279.p0 Protein 4e-43 48
Cgl0754 NP_599983.1 two-component system response regulator NC_012469.1.7685629. Protein 1e-42 48
Cgl0754 NP_599983.1 two-component system response regulator NC_007622.3794472.p0 Protein 3e-43 48
Cgl0754 NP_599983.1 two-component system response regulator NC_002745.1124361.p0 Protein 4e-43 48
Cgl0754 NP_599983.1 two-component system response regulator NC_009782.5559369.p0 Protein 4e-43 48
Cgl0754 NP_599983.1 two-component system response regulator NC_002951.3237708.p0 Protein 4e-43 48
Cgl0754 NP_599983.1 two-component system response regulator NC_002951.3238224.p0 Protein 3e-37 46
Cgl0754 NP_599983.1 two-component system response regulator NC_007793.3914065.p0 Protein 3e-37 46
Cgl0754 NP_599983.1 two-component system response regulator NC_002758.1121390.p0 Protein 3e-37 46
Cgl0754 NP_599983.1 two-component system response regulator NC_010079.5776364.p0 Protein 3e-37 46
Cgl0754 NP_599983.1 two-component system response regulator NC_002952.2859858.p0 Protein 3e-37 46
Cgl0754 NP_599983.1 two-component system response regulator NC_007622.3794948.p0 Protein 3e-37 46
Cgl0754 NP_599983.1 two-component system response regulator NC_003923.1003417.p0 Protein 3e-37 46
Cgl0754 NP_599983.1 two-component system response regulator NC_013450.8614146.p0 Protein 3e-37 46
Cgl0754 NP_599983.1 two-component system response regulator HE999704.1.gene2815. Protein 3e-40 46
Cgl0754 NP_599983.1 two-component system response regulator NC_012469.1.7686381. Protein 5e-39 45
Cgl0754 NP_599983.1 two-component system response regulator BAC0111 Protein 1e-27 43
Cgl0754 NP_599983.1 two-component system response regulator AE015929.1.gene1106. Protein 4e-31 42
Cgl0754 NP_599983.1 two-component system response regulator AE016830.1.gene1681. Protein 6e-38 42
Cgl0754 NP_599983.1 two-component system response regulator BAC0125 Protein 3e-30 42
Cgl0754 NP_599983.1 two-component system response regulator CP000675.2.gene1535. Protein 4e-33 41
Cgl0754 NP_599983.1 two-component system response regulator AF155139.2.orf0.gene Protein 6e-34 41
Cgl0754 NP_599983.1 two-component system response regulator BAC0197 Protein 8e-29 41
Cgl0754 NP_599983.1 two-component system response regulator CP001918.1.gene5135. Protein 3e-17 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Cgl0754 NP_599983.1 two-component system response regulator VFG1563 Protein 6e-37 43
Cgl0754 NP_599983.1 two-component system response regulator VFG1702 Protein 4e-37 43
Cgl0754 NP_599983.1 two-component system response regulator VFG1389 Protein 9e-28 42
Cgl0754 NP_599983.1 two-component system response regulator VFG1390 Protein 9e-31 41