Gene Information

Name : CopZ (TTE2466)
Accession : NP_623992.1
Strain : Thermoanaerobacter tengcongensis MB4
Genome accession: NC_003869
Putative virulence/resistance : Resistance
Product : copper chaperone
Function : -
COG functional category : P : Inorganic ion transport and metabolism
COG ID : COG2608
EC number : -
Position : 2356428 - 2356652 bp
Length : 225 bp
Strand : -
Note : Best Blastp hit = gi|13702508|dbj|BAB43649.1| '(AP003137) ORFID:SA2345.; hypothetical protein, similar to mercuric ion-binding protein [Staphylococcus aureus]' gi|13874260|dbj|BAB44800.1| (AP003365) hypothetical protein [Staphylococcus aureus], score 73.9

DNA sequence :
ATGGGTTTGTTTGGACCTAAGGGTGAGACTATCGTCATAAATGTTAAGGGGATGACATGCAACCATTGCAAAATGTCTGT
TGAAAATGCACTAAAGAAGTTAAATGGGGTATTGAAAGCTGTTGTTGACCTTGATAAAGGTAATGTTACGGTAACATATG
ACCCTGCTAAAGTTTCTGTCGATGATATGAAAAAAGCAATTATTGATACAGGATATGAAGTGTAA

Protein sequence :
MGLFGPKGETIVINVKGMTCNHCKMSVENALKKLNGVLKAVVDLDKGNVTVTYDPAKVSVDDMKKAIIDTGYEV

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
unnamed ABR13399.1 copper-transporting ATPase 2 Not tested PAGI-5 Protein 4e-09 44
merP CAJ77062.1 Periplasmic mercuric ion binding protein Not tested AbaR1 Protein 9e-10 44
merP ACN81007.1 MerP periplasmic mercuric ion binding protein Not tested AbaR5 Protein 1e-09 44
merP ABQ57373.1 MerP Not tested SGI1 Protein 2e-09 43
merP AET25399.1 MerP Not tested PAGI-2(C) Protein 2e-09 43
merP AFG30122.1 MerP Not tested PAGI-2 Protein 2e-09 43
merP AGK07023.1 MerP Not tested SGI1 Protein 2e-09 43
merP AGK07081.1 MerP Not tested SGI1 Protein 2e-09 43
merP YP_006098389.1 mercuric ion transport protein Not tested Tn2411 Protein 3e-09 43

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
CopZ NP_623992.1 copper chaperone BAC0634 Protein 3e-07 44
CopZ NP_623992.1 copper chaperone BAC0679 Protein 1e-08 41