Gene Information

Name : SCC8A.26c (SCO2368)
Accession : NP_626615.1
Strain : Streptomyces coelicolor A3(2)
Genome accession: NC_003888
Putative virulence/resistance : Resistance
Product : hypothetical protein
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG2310
EC number : -
Position : 2537340 - 2537915 bp
Length : 576 bp
Strand : -
Note : SCC8A.26c, conserved hypothetical protein, len: 191aa; similar to proteins associated with resistance to tellurium salts e.g. SW:Q52357 (TERD_SERMA) tellurium resistance protein TerD from Serratia marcescens (192 aa) fasta scores; opt: 866, z-score: 1036.

DNA sequence :
GTGGGAGTCAGCCTCAGCAAGGGCGGCAACGTTTCGCTGACCAAGGAGGCCCCCGGCCTGACCGCGGTCATCGTCGGTCT
GGGGTGGGACATCCGCACCACGACCGGCACCGACTTCGACCTCGACGCCAGCGCACTGCTGCTGAACAGCGGCGGCAAGG
TCGCCAGCGACGCGCACTTCATCTTCTTCAACAACCTGAAGAGCCCGGACGGATCGGTCGAGCACACCGGCGACAACATC
ACCGGTGAGGGCGAGGGCGACGACGAGCAGATCAAGATCAACCTCGCCACGGTCCCCGCCGACATCGAGAAGATCGTCTT
CCCGGTCTCGATCTACGACGCCGAGAACCGCCAGCAGTCTTTCGGCCAGGTGCGCAACGCGTTCATCCGCGTCGTCAACC
AGGCCGGCGAGGCCGAGATCGCCCGCTACGACCTGAGCGAGGACGCCTCCACCGAGACCGCCATGGTCTTCGGCGAGCTG
TACCGCCACGGCGCGGAGTGGAAGTTCCGCGCCATCGGCCAGGGCTACGCCTCGGGCCTGCGCGGCATCGCCCAGGACTT
CGGCGTCAACGTCTGA

Protein sequence :
MGVSLSKGGNVSLTKEAPGLTAVIVGLGWDIRTTTGTDFDLDASALLLNSGGKVASDAHFIFFNNLKSPDGSVEHTGDNI
TGEGEGDDEQIKINLATVPADIEKIVFPVSIYDAENRQQSFGQVRNAFIRVVNQAGEAEIARYDLSEDASTETAMVFGEL
YRHGAEWKFRAIGQGYASGLRGIAQDFGVNV

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
terE NP_286711.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 2e-60 69
terE_2 NP_287119.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 2e-60 69
tlrB AAF36434.1 putative tellurium resistance protein B Not tested TAI Protein 1e-60 69
unnamed ACY75542.1 tellurium-resistance protein Not tested Tn6060 Protein 5e-65 68
terD NP_286710.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 2e-63 67
terD_2 NP_287118.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 2e-63 67
tlrC AAF36435.1 putative tellurium resistance protein C Not tested TAI Protein 5e-63 66
unnamed ACY75541.1 tellurium-resistance protein Not tested Tn6060 Protein 2e-57 65
terZ NP_286706.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 5e-29 44
terZ_2 NP_287114.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 5e-29 44
terZ ACY75546.1 tellurite resistance protein TerZ Not tested Tn6060 Protein 4e-31 42

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
SCC8A.26c NP_626615.1 hypothetical protein BAC0389 Protein 3e-63 67
SCC8A.26c NP_626615.1 hypothetical protein BAC0390 Protein 2e-61 64
SCC8A.26c NP_626615.1 hypothetical protein BAC0392 Protein 2e-28 43