Gene Information

Name : 2SCK8.33c; afsQ1 (SCO4907)
Accession : NP_629060.1
Strain : Streptomyces coelicolor A3(2)
Genome accession: NC_003888
Putative virulence/resistance : Virulence
Product : transcriptional regulator
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG0745
EC number : -
Position : 5339525 - 5340202 bp
Length : 678 bp
Strand : -
Note : 2SCK8.33c, afsQ1, transcriptional regulatory protein, len: 225 aa; identical to previously sequenced SW:AFQ1_STRCO (EMBL:D10654) Streptomyces coelicolor transcriptional regulatory protein AfsQ1, 225 aa and highly similar to TR:Q9K455 (EMBL:AL359215) Strep

DNA sequence :
GTGCCTTCCCTGTTGCTGATCGAGGACGACGACGCCATCCGTACGGCCCTGGAGCTCTCCCTGACCCGCCAGGGCCACCG
GGTGGCCACCGCTGCCAGTGGTGAGGACGGTCTGAAGCTCTTGCGCGAGCAGCGGCCGGACCTGATCGTGCTGGACGTGA
TGCTGCCCGGCATCGACGGTTTCGAGGTGTGCCGTCGCATCCGGCGCACCGACCAGCTGCCGATCATTCTGCTGACCGCG
CGCAACGACGACATCGACGTGGTCGTCGGTCTCGAGTCGGGCGCCGACGACTACGTCGTCAAACCCGTCCAGGGCCGGGT
GCTCGACGCCCGGATCCGGGCCGTGCTGCGGCGCGGGGAGCGGGAGTCCACCGACTCGGCGAGCTTCGGCAGTCTGGTCA
TCGACCGTTCGGCGATGACCGTGACGAAGAACGGCGAGGACCTCCAGCTGACGCCCACCGAGCTGCGGCTGCTCCTGGAG
CTGAGCCGGCGGCCGGGACAGGCGCTGTCCCGGCAGCAGTTGCTGCGGCTGGTGTGGGAGCACGACTACCTCGGCGACTC
CCGGCTGGTGGACGCGTGCGTGCAGCGGCTGCGCGCCAAGGTCGAGGACGTGCCGTCGTCCCCGACCCTGATCCGTACCG
TGCGCGGTGTCGGCTACCGGCTGGATCCGCCTCAGTGA

Protein sequence :
MPSLLLIEDDDAIRTALELSLTRQGHRVATAASGEDGLKLLREQRPDLIVLDVMLPGIDGFEVCRRIRRTDQLPIILLTA
RNDDIDVVVGLESGADDYVVKPVQGRVLDARIRAVLRRGERESTDSASFGSLVIDRSAMTVTKNGEDLQLTPTELRLLLE
LSRRPGQALSRQQLLRLVWEHDYLGDSRLVDACVQRLRAKVEDVPSSPTLIRTVRGVGYRLDPPQ

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
copR NP_460069.2 transcriptional regulatory protein YedW Not tested SPI-5 Protein 8e-24 42

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
2SCK8.33c; afsQ1 NP_629060.1 transcriptional regulator AE000516.2.gene3505. Protein 3e-35 48
2SCK8.33c; afsQ1 NP_629060.1 transcriptional regulator NC_002952.2859905.p0 Protein 9e-38 44
2SCK8.33c; afsQ1 NP_629060.1 transcriptional regulator NC_002745.1124361.p0 Protein 1e-37 44
2SCK8.33c; afsQ1 NP_629060.1 transcriptional regulator NC_009782.5559369.p0 Protein 1e-37 44
2SCK8.33c; afsQ1 NP_629060.1 transcriptional regulator NC_002951.3237708.p0 Protein 1e-37 44
2SCK8.33c; afsQ1 NP_629060.1 transcriptional regulator NC_003923.1003749.p0 Protein 1e-37 44
2SCK8.33c; afsQ1 NP_629060.1 transcriptional regulator NC_002758.1121668.p0 Protein 1e-37 44
2SCK8.33c; afsQ1 NP_629060.1 transcriptional regulator NC_007622.3794472.p0 Protein 8e-38 44
2SCK8.33c; afsQ1 NP_629060.1 transcriptional regulator NC_009641.5332272.p0 Protein 1e-37 44
2SCK8.33c; afsQ1 NP_629060.1 transcriptional regulator NC_013450.8614421.p0 Protein 1e-37 44
2SCK8.33c; afsQ1 NP_629060.1 transcriptional regulator NC_007793.3914279.p0 Protein 1e-37 44
2SCK8.33c; afsQ1 NP_629060.1 transcriptional regulator NC_012469.1.7685629. Protein 6e-40 43
2SCK8.33c; afsQ1 NP_629060.1 transcriptional regulator NC_010079.5776364.p0 Protein 3e-32 42
2SCK8.33c; afsQ1 NP_629060.1 transcriptional regulator NC_002952.2859858.p0 Protein 3e-32 42
2SCK8.33c; afsQ1 NP_629060.1 transcriptional regulator NC_007622.3794948.p0 Protein 3e-32 42
2SCK8.33c; afsQ1 NP_629060.1 transcriptional regulator NC_003923.1003417.p0 Protein 3e-32 42
2SCK8.33c; afsQ1 NP_629060.1 transcriptional regulator NC_013450.8614146.p0 Protein 3e-32 42
2SCK8.33c; afsQ1 NP_629060.1 transcriptional regulator NC_002951.3238224.p0 Protein 3e-32 42
2SCK8.33c; afsQ1 NP_629060.1 transcriptional regulator NC_007793.3914065.p0 Protein 3e-32 42
2SCK8.33c; afsQ1 NP_629060.1 transcriptional regulator NC_002758.1121390.p0 Protein 3e-32 42
2SCK8.33c; afsQ1 NP_629060.1 transcriptional regulator BAC0197 Protein 2e-26 42
2SCK8.33c; afsQ1 NP_629060.1 transcriptional regulator CP000675.2.gene1535. Protein 5e-28 41
2SCK8.33c; afsQ1 NP_629060.1 transcriptional regulator BAC0125 Protein 5e-25 41
2SCK8.33c; afsQ1 NP_629060.1 transcriptional regulator NC_012469.1.7686381. Protein 7e-33 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
2SCK8.33c; afsQ1 NP_629060.1 transcriptional regulator VFG0596 Protein 3e-24 42
2SCK8.33c; afsQ1 NP_629060.1 transcriptional regulator VFG1389 Protein 6e-23 42
2SCK8.33c; afsQ1 NP_629060.1 transcriptional regulator VFG1390 Protein 9e-28 41