Gene Information

Name : SC8F4.07 (SCO5403)
Accession : NP_629542.1
Strain : Streptomyces coelicolor A3(2)
Genome accession: NC_003888
Putative virulence/resistance : Resistance
Product : two-component system response regulator
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG0745
EC number : -
Position : 5875298 - 5875966 bp
Length : 669 bp
Strand : +
Note : SC8F4.07, probable two-component system response regulator, len: 222 aa; similar to many e.g. SW:Q02540 (COPR_PSESM) CopR transcriptional activator protein from Pseudomonas syringae (pv. tomato) (227 aa) fasta scores; opt: 621, z-score: 735.4, E(): 0, 45.

DNA sequence :
ATGCGCCTGTTGATCGTGGAGGACGAGAAGCGCCTCGCCGTGTCGCTCGCCAAGGGCCTCACCGCGGAGGGATACGCCGT
GGACGTCGTCCACGACGGCCTGGAGGGACTGCACCGGGCGGGTGAGGGCGTGTACGACCTCGTCATCCTCGACATCATGC
TGCCCGGCCTCAACGGCTACCGGGTCTGCGCCGCCCTGCGCGCCGCCGGACACGACGTGCCGATCCTGATGCTCACCGCC
AAGGACGGCGAGTACGACGAGGCCGAGGGCCTGGACACGGGCGCGGACGACTACCTCACCAAGCCCTTCTCCTACGTCGT
CCTCGTCGCCCGGGTGAAGGCCCTGCTGCGGCGGCGCGGGCAGGGGGCCGGAGCCTCGCCCGTGCACGTCCACGGCGACC
TCAGGGTCGACACCGCCGCCCGCCGGGTCTTCCTCGGCGAGGACGAGGCCACCCTCACCGCCAAGGAGTTCGCCGTCCTG
GAGCAGCTCGTGGTGCGGGCCGGGCAGGTGGTCTCCAAGGCGGAGATCCTGGAGCACGTCTGGGACTTCGCCTACGACGG
CGACCCCAACATCGTCGAGGTGTACGTCAGCGCGCTGCGGCGCAAGCTGCGTGCCGGGCTCATCCGGACCGTGCGCGGCG
CCGGCTACCGGCTGGAGACCGGGCGGTGA

Protein sequence :
MRLLIVEDEKRLAVSLAKGLTAEGYAVDVVHDGLEGLHRAGEGVYDLVILDIMLPGLNGYRVCAALRAAGHDVPILMLTA
KDGEYDEAEGLDTGADDYLTKPFSYVVLVARVKALLRRRGQGAGASPVHVHGDLRVDTAARRVFLGEDEATLTAKEFAVL
EQLVVRAGQVVSKAEILEHVWDFAYDGDPNIVEVYVSALRRKLRAGLIRTVRGAGYRLETGR

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
copR NP_460069.2 transcriptional regulatory protein YedW Not tested SPI-5 Protein 2e-31 42
copR AAC33719.1 regulatory protein CopR Not tested SPI-5 Protein 9e-31 42
vanRB NP_815956.1 DNA-binding response regulator VanRB Not tested Not named Protein 4e-27 41

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
SC8F4.07 NP_629542.1 two-component system response regulator BAC0111 Protein 5e-36 46
SC8F4.07 NP_629542.1 two-component system response regulator BAC0083 Protein 4e-36 46
SC8F4.07 NP_629542.1 two-component system response regulator BAC0638 Protein 1e-31 45
SC8F4.07 NP_629542.1 two-component system response regulator U82965.2.orf14.gene. Protein 3e-24 45
SC8F4.07 NP_629542.1 two-component system response regulator BAC0197 Protein 3e-34 44
SC8F4.07 NP_629542.1 two-component system response regulator BAC0125 Protein 7e-36 43
SC8F4.07 NP_629542.1 two-component system response regulator BAC0308 Protein 4e-36 43
SC8F4.07 NP_629542.1 two-component system response regulator BAC0347 Protein 3e-29 43
SC8F4.07 NP_629542.1 two-component system response regulator Y16952.3.orf35.gene. Protein 1e-22 43
SC8F4.07 NP_629542.1 two-component system response regulator NC_002952.2859905.p0 Protein 2e-33 42
SC8F4.07 NP_629542.1 two-component system response regulator NC_007793.3914279.p0 Protein 3e-33 42
SC8F4.07 NP_629542.1 two-component system response regulator NC_007622.3794472.p0 Protein 2e-33 42
SC8F4.07 NP_629542.1 two-component system response regulator NC_002745.1124361.p0 Protein 3e-33 42
SC8F4.07 NP_629542.1 two-component system response regulator NC_009782.5559369.p0 Protein 3e-33 42
SC8F4.07 NP_629542.1 two-component system response regulator NC_002951.3237708.p0 Protein 3e-33 42
SC8F4.07 NP_629542.1 two-component system response regulator NC_003923.1003749.p0 Protein 2e-33 42
SC8F4.07 NP_629542.1 two-component system response regulator NC_002758.1121668.p0 Protein 3e-33 42
SC8F4.07 NP_629542.1 two-component system response regulator NC_009641.5332272.p0 Protein 3e-33 42
SC8F4.07 NP_629542.1 two-component system response regulator NC_013450.8614421.p0 Protein 3e-33 42
SC8F4.07 NP_629542.1 two-component system response regulator NC_002516.2.879194.p Protein 3e-22 42
SC8F4.07 NP_629542.1 two-component system response regulator AE016830.1.gene2255. Protein 2e-27 41
SC8F4.07 NP_629542.1 two-component system response regulator U35369.1.gene1.p01 Protein 2e-27 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
SC8F4.07 NP_629542.1 two-component system response regulator VFG1389 Protein 2e-30 45
SC8F4.07 NP_629542.1 two-component system response regulator VFG1390 Protein 1e-37 44
SC8F4.07 NP_629542.1 two-component system response regulator VFG1386 Protein 5e-32 43
SC8F4.07 NP_629542.1 two-component system response regulator VFG0596 Protein 5e-32 42