
|
Name : BA_0775 (BA_0775) Accession : NP_843297.1 Strain : Bacillus anthracis Ames Genome accession: NC_003997 Putative virulence/resistance : Resistance Product : hypothetical protein Function : - COG functional category : S : Function unknown COG ID : COG1937 EC number : - Position : 793654 - 793917 bp Length : 264 bp Strand : + Note : 'similar to GP:6332750, and GP:6332750; identified by sequence similarity' DNA sequence : ATGGAATATAATCAAGATATGAAAAATAGATTGAAACGCATTGAAGGTCAAGTTCGTGGCGTGCTTCGTATGATGGAAGA AGGAAAAGATTGCCGAGAGGTTATTACACAGTTAACGGCATCTCGTTCTGCACTTGATCGTACAATTGGCCTCGTTGTTG GAACAAATTTAGAGCAATGTTTACGTGAACAGTTTGAAAGTGGTAATGGTTCAAATGAAGAATTAATTAAAGAAGCTGTT CAATTACTTGTAAAAAGCCGATAA Protein sequence : MEYNQDMKNRLKRIEGQVRGVLRMMEEGKDCREVITQLTASRSALDRTIGLVVGTNLEQCLREQFESGNGSNEELIKEAV QLLVKSR |
| Gene | GenBank Accn | Product | Virulance or Resistance | PAI or REI | Alignment Type | E-val | Identity |
| unnamed | BAA82210.2 | - | Not tested | Type-II SCCmec | Protein | 3e-19 | 50 |
| SAV0048 | NP_370572.1 | hypothetical protein | Not tested | Type-II SCCmec | Protein | 4e-19 | 50 |
| unnamed | BAA82170.2 | - | Not tested | Type-II SCCmec | Protein | 1e-19 | 50 |
| SA0045 | NP_373285.1 | hypothetical protein | Not tested | Type-II SCCmec | Protein | 4e-19 | 50 |
| SERP2514 | YP_190056.1 | hypothetical protein | Not tested | Type-II SCCmec | Protein | 4e-19 | 50 |
| unnamed | BAC57484.1 | hypothetical protein | Not tested | Type-IIIinv SCCmec | Protein | 3e-19 | 50 |
| unnamed | BAB47614.1 | hypothetical protein | Not tested | Type-III SCCmec | Protein | 3e-19 | 50 |
| unnamed | BAA86632.1 | hypothetical protein | Not tested | Type-I SCCmec | Protein | 6e-20 | 50 |
| SAR0047 | YP_039520.1 | hypothetical protein | Not tested | Type-II SCCmec | Protein | 4e-19 | 50 |
| SACOL0048 | YP_184958.1 | hypothetical protein | Not tested | Type-I SCCmec | Protein | 2e-18 | 48 |
| SAPIG0063 | YP_005732873.1 | conserved protein YrkD | Not tested | Type-V SCCmec | Protein | 2e-18 | 48 |
| unnamed | BAB83476.1 | - | Not tested | SCC 12263 | Protein | 3e-16 | 47 |
| unnamed | BAA94324.1 | hypothetical protein | Not tested | Type-I SCCmec | Protein | 2e-16 | 46 |
| Gene | GenBank Accn | Product | ID of source DB | Alignment Type | E-val | Identity |
| BA_0775 | NP_843297.1 | hypothetical protein | BAC0333 | Protein | 1e-09 | 41 |