Gene Information

Name : RHE_PD00242 (RHE_PD00242)
Accession : NP_659796.2
Strain :
Genome accession: NC_004041
Putative virulence/resistance : Unknown
Product : insertion sequence transposase
Function : -
COG functional category : L : Replication, recombination and repair
COG ID : COG3436
EC number : -
Position : 260293 - 260616 bp
Length : 324 bp
Strand : -
Note : similar to blr0035 [Bradyrhizobium japonicum]; location:bacterial cytoplasm Psort-Score: 0.1852

DNA sequence :
GTGTGGATCGCGGGCGGGGTGACGGACATGCGTTGCGGCATGAACAGCCTGGCGCTGAAGGTTCAGCAAGGTCTTGGCCG
CGATCCTCATGGCGGCGAAGTCTTCTGCTTCCGGGGTCGCAAGGGTGACCTGATCAAGGTCCTCTGGCATGACGGCGTCG
GCATGTCGCTTTACCTGAAGCGGCTGGAAGCTGGAAAGTTCATCTGGCCGGTCAGCCAGAATGGCTCCGCCGTGCCTGTA
TCGTCGGCGCAGCTCGGCTATCTCCTGGAAGGGATCGACTGGCGCAACCCGCGCTGGACGCAGCGGCCTTCGAAGGCAGG
CTGA

Protein sequence :
MWIAGGVTDMRCGMNSLALKVQQGLGRDPHGGEVFCFRGRKGDLIKVLWHDGVGMSLYLKRLEAGKFIWPVSQNGSAVPV
SSAQLGYLLEGIDWRNPRWTQRPSKAG

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
BCAM0247 YP_002232879.1 putative transposase Not tested BcenGI11 Protein 5e-22 58
aec52 AAW51735.1 Aec52 Not tested AGI-3 Protein 6e-25 53
unnamed ADD91739.1 hypothetical protein Not tested PAI-I AL862 Protein 6e-25 53
pB171ORF50 CAD66190.1 ORF50 protein of pB171 Not tested PAI III 536 Protein 5e-25 53
ECUMN_3327 YP_002414007.1 putative transposase ORF2, IS66 family Not tested Not named Protein 6e-21 53
unnamed AAC31493.1 L0014 Not tested LEE Protein 6e-21 53
Z1132 NP_286667.1 hypothetical protein Not tested TAI Protein 1e-20 53
hp4 AAC61716.1 Hp4 Not tested PAI I CFT073 Protein 6e-21 53
Z1571 NP_287075.1 hypothetical protein Not tested TAI Protein 1e-20 53
unnamed AAL99258.1 unknown Not tested LEE Protein 6e-21 53
c3578 NP_755453.1 hypothetical protein Not tested PAI I CFT073 Protein 8e-21 53
unnamed ACU09438.1 IS66 family element orf2 Not tested LEE Protein 6e-21 53
Z4336 NP_289561.1 hypothetical protein Not tested OI-122 Protein 8e-21 53
Z5097 NP_290248.1 prophage-associated protein Not tested LEE Protein 8e-21 53
ECs4546 NP_312573.1 hypothetical protein Not tested LEE Protein 8e-21 53
c3561 NP_755436.1 hypothetical protein Not tested PAI I CFT073 Protein 6e-21 53
ECO103_3553 YP_003223420.1 hypothetical protein Not tested LEE Protein 1e-25 52
Z4316 NP_289542.1 hypothetical protein Not tested OI-122 Protein 1e-25 52
l0014 CAD33776.1 L0014 protein Not tested PAI I 536 Protein 1e-14 51
unnamed AAL08461.1 unknown Not tested SRL Protein 1e-20 51
Z1160 NP_286695.1 hypothetical protein Not tested TAI Protein 1e-21 48
Z1599 NP_287103.1 hypothetical protein Not tested TAI Protein 1e-21 48
Z4338 NP_289563.1 hypothetical protein Not tested OI-122 Protein 2e-20 46
ECUMN_3364 YP_002414037.1 putative transposase ORF2, IS66 family Not tested Not named Protein 1e-21 46
ECO103_3567 YP_003223430.1 hypothetical protein Not tested LEE Protein 2e-20 46

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
RHE_PD00242 NP_659796.2 insertion sequence transposase VFG1665 Protein 2e-25 53
RHE_PD00242 NP_659796.2 insertion sequence transposase VFG0792 Protein 2e-21 53
RHE_PD00242 NP_659796.2 insertion sequence transposase VFG1698 Protein 2e-21 53
RHE_PD00242 NP_659796.2 insertion sequence transposase VFG1709 Protein 2e-21 53
RHE_PD00242 NP_659796.2 insertion sequence transposase VFG1517 Protein 5e-15 51
RHE_PD00242 NP_659796.2 insertion sequence transposase VFG1052 Protein 5e-21 51
RHE_PD00242 NP_659796.2 insertion sequence transposase VFG1737 Protein 4e-22 46