Gene Information

Name : csrR (SpyM3_0244)
Accession : NP_664048.1
Strain : Streptococcus pyogenes MGAS315
Genome accession: NC_004070
Putative virulence/resistance : Virulence
Product : two-component response regulator
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG0745
EC number : -
Position : 283631 - 284317 bp
Length : 687 bp
Strand : +
Note : best blastp hit: gb|AAC64935.1| (AF082668) CsrR [Streptococcus pyogenes]

DNA sequence :
ATGACAAAGAAAATTTTAATTATTGAAGATGAAAAGAATCTGGCTAGATTCGTTTCTCTTGAGCTGCAACATGAGGGGTA
TGAAGTCATTGTTGAGGTCAATGGTCGTGAAGGGTTAGAAACTGCTTTGGAAAAAGAGTTTGATTTAATCCTGCTTGACT
TAATGTTACCAGAGATGGATGGTTTTGAAGTGACCCGTCGTTTGCAAACCGAAAAAACAACGTATATCATGATGATGACT
GCGCGTGATTCTATTATGGATGTGGTTGCAGGTTTAGACCGCGGTGCAGACGACTATATTGTTAAACCGTTTGCCATTGA
AGAACTACTTGCCCGTATTCGTGCTATTTTCCGCCGTCAAGATATTGAATCTGAGAAGAAAGTGCCTAGTCAAGGCATTT
ATCGAGATCTAGTTTTAAATCCACAAAACCGTTCAGTTAATCGTGGCGACGATGAGATTTCTCTCACTAAACGTGAATAT
GATTTGCTTAATATTTTGATGACTAATATGAATCGTGTCATGACACGTGAAGAATTATTGTCAAATGTTTGGAAATATGA
TGAAGCCGTTGAGACTAATGTTGTAGATGTCTATATTCGTTATCTCCGCGGCAAAATTGACATTCCAGGCAAGGAATCTT
ATATCCAAACAGTGCGTGGCATGGGATACGTTATTCGTGAGAAATAA

Protein sequence :
MTKKILIIEDEKNLARFVSLELQHEGYEVIVEVNGREGLETALEKEFDLILLDLMLPEMDGFEVTRRLQTEKTTYIMMMT
ARDSIMDVVAGLDRGADDYIVKPFAIEELLARIRAIFRRQDIESEKKVPSQGIYRDLVLNPQNRSVNRGDDEISLTKREY
DLLNILMTNMNRVMTREELLSNVWKYDEAVETNVVDVYIRYLRGKIDIPGKESYIQTVRGMGYVIREK

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
copR NP_460069.2 transcriptional regulatory protein YedW Not tested SPI-5 Protein 8e-37 43
copR AAC33719.1 regulatory protein CopR Not tested SPI-5 Protein 3e-36 43
c3565 NP_755440.1 response regulator Not tested PAI I CFT073 Protein 4e-33 41

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
csrR NP_664048.1 two-component response regulator HE999704.1.gene1528. Protein 6e-59 62
csrR NP_664048.1 two-component response regulator AE015929.1.gene1106. Protein 3e-49 54
csrR NP_664048.1 two-component response regulator NC_013450.8614146.p0 Protein 3e-51 53
csrR NP_664048.1 two-component response regulator NC_002951.3238224.p0 Protein 3e-51 53
csrR NP_664048.1 two-component response regulator NC_007793.3914065.p0 Protein 3e-51 53
csrR NP_664048.1 two-component response regulator NC_002758.1121390.p0 Protein 3e-51 53
csrR NP_664048.1 two-component response regulator NC_010079.5776364.p0 Protein 3e-51 53
csrR NP_664048.1 two-component response regulator NC_002952.2859858.p0 Protein 3e-51 53
csrR NP_664048.1 two-component response regulator NC_007622.3794948.p0 Protein 3e-51 53
csrR NP_664048.1 two-component response regulator NC_003923.1003417.p0 Protein 3e-51 53
csrR NP_664048.1 two-component response regulator NC_012469.1.7685629. Protein 2e-38 43
csrR NP_664048.1 two-component response regulator HE999704.1.gene2815. Protein 3e-39 42
csrR NP_664048.1 two-component response regulator BAC0125 Protein 7e-36 41
csrR NP_664048.1 two-component response regulator AE016830.1.gene1681. Protein 3e-39 41
csrR NP_664048.1 two-component response regulator BAC0197 Protein 2e-32 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
csrR NP_664048.1 two-component response regulator VFG1390 Protein 3e-41 43
csrR NP_664048.1 two-component response regulator VFG0596 Protein 3e-37 43
csrR NP_664048.1 two-component response regulator VFG1702 Protein 2e-33 41