Name : emrE (y2000) Accession : NP_669315.1 Strain : Yersinia pestis KIM Genome accession: NC_004088 Putative virulence/resistance : Resistance Product : quaternary ammonium compound-resistance protein Function : - COG functional category : P : Inorganic ion transport and metabolism COG ID : COG2076 EC number : - Position : 2203701 - 2204039 bp Length : 339 bp Strand : + Note : residues 3 to 112 of 112 are 50.90 pct identical to residues 1 to 110 of 110 from E. coli K12 : B0543; residues 3 to 112 of 112 are 54.54 pct identical to residues 1 to 110 of 110 from GenPept : >gb|AAC64463.1| (U67194) QacE [Enterobacter aerogenes] DNA sequence : GTGATAATGAGCAGTTTTGTCTATTTATTTATGGCGATTATTGCCGAAGTGGTTGCGACGACGATGCTAAAAGCATCCGA TGGTTTTTCTCGATTAGTCCCATCAGTGGTTGTCGTGATTGGTTATGGTATTGCTTTTTGGGGGCTTTCGCAGGTAGTTA AAACCATGCCGCTGGGTATTGCTTATGCGATTTGGTCCGGTTTGGGGATTGTACTGGTCTCAATCGCTGCCACCTTTATG TATCAACAAAAGCTGGATTGGGCGGCGGTTGTCGGTATGGCGCTGATTATTTCGGGTGTTATGGTGATTAACCTCCTGTC CAAGACACCGATGCATTAA Protein sequence : MIMSSFVYLFMAIIAEVVATTMLKASDGFSRLVPSVVVVIGYGIAFWGLSQVVKTMPLGIAYAIWSGLGIVLVSIAATFM YQQKLDWAAVVGMALIISGVMVINLLSKTPMH |
Gene | GenBank Accn | Product | Virulance or Resistance | PAI or REI | Alignment Type | E-val | Identity |
qacEdelta1 | AGK06979.1 | QacEdelta1 | Not tested | SGI1 | Protein | 9e-19 | 51 |
qacE-delta1 | ACY75532.1 | QacE-delta1 | Not tested | Tn6060 | Protein | 9e-19 | 51 |
qacEdelta1 | ABB48428.1 | QacEdelta1 | Not tested | SGI1 | Protein | 9e-19 | 51 |
ACICU_00227 | YP_001844886.1 | membrane transporter | Not tested | AbaR20 | Protein | 1e-18 | 51 |
qacEdelta1 | AGK07016.1 | QacEdelta1 | Not tested | SGI1 | Protein | 9e-19 | 51 |
qacE-delta1 | AET25389.1 | QacE-delta1 | Not tested | PAGI-2(C) | Protein | 9e-19 | 51 |
qacEdelta1 | ABZ01839.1 | QacEdelta1 | Not tested | SGI2 | Protein | 9e-19 | 51 |
qacEdelta1 | YP_005797134.1 | quaternary ammonium compound-resistance protein | Not tested | AbaR4e | Protein | 1e-18 | 51 |
qacEdelta1 | AGK07074.1 | QacEdelta1 | Not tested | SGI1 | Protein | 9e-19 | 51 |
qacE-delta1 | AFG30112.1 | QacE-delta1 | Not tested | PAGI-2 | Protein | 9e-19 | 51 |
qacEdelta1 | CAJ77030.1 | Quaternary ammonium compound-resistance protein | Not tested | AbaR1 | Protein | 9e-19 | 51 |
qacEdelta1 | YP_005797150.1 | quaternary ammonium compound-resistance protein | Not tested | AbaR4e | Protein | 1e-18 | 51 |
qacEdelta1 | AGK07100.1 | QacEdelta1 | Not tested | SGI1 | Protein | 9e-19 | 51 |
qacEdelta1 | AGF34989.1 | QacEdelta1 | Not tested | SGI1 | Protein | 9e-19 | 51 |
qacEdelta1 | CAJ77049.1 | Quaternary ammonium compound-resistance protein | Not tested | AbaR1 | Protein | 9e-19 | 51 |
ebr | YP_006098377.1 | putative ethidium bromide resistance protein | Not tested | Tn2411 | Protein | 1e-18 | 51 |
qacEdelta1 | AGK07109.1 | QacEdelta1 | Not tested | SGI1 | Protein | 9e-19 | 51 |
qacEdelta1 | AGF35028.1 | QacEdelta1 | Not tested | SGI1 | Protein | 9e-19 | 51 |
qacEdelta1 | CAJ77052.1 | Quaternary ammonium compound-resistance protein | Not tested | AbaR1 | Protein | 9e-19 | 51 |
qacEdelta1 | ACN81026.1 | QacEdelta1 | Not tested | AbaR5 | Protein | 1e-18 | 51 |
qacEdelta1 | AGF35063.1 | QacEdelta1 | Not tested | SGI1 | Protein | 9e-19 | 51 |
qacEdelta1 | CAJ77088.1 | Quaternary ammonium compound-resistance protein | Not tested | AbaR1 | Protein | 9e-19 | 51 |
qacEdelta1 | AFV53123.1 | QacEdelta1 multidrug exporter | Not tested | AbGRI2-1 | Protein | 9e-19 | 51 |
qacEdelta1 | AGK06933.1 | QacEdelta1 | Not tested | SGI1 | Protein | 9e-19 | 51 |
qacE-deltal | ACF06159.1 | quartenary ammonium compound resistance protein | Not tested | Tn5036-like | Protein | 9e-19 | 51 |
qacEdelta1 | AAK02047.1 | quaternary ammonium compound and disinfectant protein | Not tested | SGI1 | Protein | 9e-19 | 51 |
qacEdelta1 | AGK36647.1 | QacEdelta1 | Not tested | AbaR26 | Protein | 9e-19 | 51 |
qacEdelta1 | AGK06970.1 | QacEdelta1 | Not tested | SGI1 | Protein | 9e-19 | 51 |
qacE-delta1 | ACY75523.1 | QacE-delta1 | Not tested | Tn6060 | Protein | 9e-19 | 51 |
qacEdelta1 | AAK02056.1 | quaternary ammonium compound and disinfectant protein | Not tested | SGI1 | Protein | 9e-19 | 51 |
unnamed | CAD42067.1 | hypothetical protein | Not tested | PAI II 536 | Protein | 7e-16 | 41 |
Gene | GenBank Accn | Product | ID of source DB | Alignment Type | E-val | Identity |
emrE | NP_669315.1 | quaternary ammonium compound-resistance protein | BAC0377 | Protein | 5e-37 | 76 |
emrE | NP_669315.1 | quaternary ammonium compound-resistance protein | CP004022.1.gene1549. | Protein | 8e-35 | 73 |
emrE | NP_669315.1 | quaternary ammonium compound-resistance protein | BAC0324 | Protein | 5e-22 | 58 |
emrE | NP_669315.1 | quaternary ammonium compound-resistance protein | BAC0322 | Protein | 5e-23 | 55 |
emrE | NP_669315.1 | quaternary ammonium compound-resistance protein | CP001138.1.gene1489. | Protein | 1e-23 | 55 |
emrE | NP_669315.1 | quaternary ammonium compound-resistance protein | NC_002695.1.913273.p | Protein | 3e-21 | 53 |
emrE | NP_669315.1 | quaternary ammonium compound-resistance protein | NC_010410.6003348.p0 | Protein | 2e-20 | 52 |
emrE | NP_669315.1 | quaternary ammonium compound-resistance protein | BAC0002 | Protein | 2e-20 | 52 |
emrE | NP_669315.1 | quaternary ammonium compound-resistance protein | BAC0150 | Protein | 4e-21 | 51 |
emrE | NP_669315.1 | quaternary ammonium compound-resistance protein | BAC0323 | Protein | 4e-19 | 51 |
emrE | NP_669315.1 | quaternary ammonium compound-resistance protein | BAC0329 | Protein | 3e-16 | 44 |
emrE | NP_669315.1 | quaternary ammonium compound-resistance protein | BAC0192 | Protein | 3e-14 | 43 |
emrE | NP_669315.1 | quaternary ammonium compound-resistance protein | BAC0140 | Protein | 6e-12 | 41 |
Gene | GenBank Accn | Product | ID of source DB | Alignment Type | E-val | Identity |
emrE | NP_669315.1 | quaternary ammonium compound-resistance protein | VFG1586 | Protein | 3e-16 | 41 |