Gene Information

Name : terD (y0559)
Accession : NP_667896.1
Strain : Yersinia pestis KIM
Genome accession: NC_004088
Putative virulence/resistance : Resistance
Product : tellurium resistance protein
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG2310
EC number : -
Position : 625850 - 626434 bp
Length : 585 bp
Strand : +
Note : residues 3 to 194 of 194 are 86.45 pct identical to residues 1 to 192 of 192 from GenPept : >gb|AAG55729.1|AE005310_5 (AE005310) phage inhibition, colicin resistance and tellurite resistance protein [Escherichia coli O157:H7 EDL933]

DNA sequence :
ATGAAAATGGGTGTATCTCTTTCGAAAGGCGGTAATGTCTCCCTGAGTAAAGAAGCTCCAACAATGACGAATGTGCTGAT
TGGCCTCGGCTGGGATGCCCGTTCTACAGATGGTCAGGATTTCGACCTGGATGCTTCAGCTTTTCTTTTGACTGCAAACG
GCAAAGTACGTAACGATGCAGATTTCATTTTCTACAACAATCTGAAATCATCTGATGGTTCAGTGATGCACACCGGTGAT
AACCGTACTGGTGAAGGCGAGGGTGACGATGAGTCGCTGAAAATCAAATTGCCTTTGATCCCAGCAGATGTGGATAAGAT
TGTTTTCGTTGTCACTATTCATGATGCTCAGGCGCGCCGTCAGAGCTTCGGTCAGGTGGCTAATGCCTTTATTCGCCTGG
TAAACGATGATAATGGCGTTGAAATTGCGCGTTACGACCTGTCTGAAGATGCGTCCACCGAAACAGCGATGCTGTTTGGT
GAGCTGTATCGCCATAATGCGGAGTGGAAATTCCGTGCGGTAGGTCAGGGCTATGCGGGTGGTTTGTCGTCTGTTTGTGC
TCAGTATGGCATCAACGCATCTTAA

Protein sequence :
MKMGVSLSKGGNVSLSKEAPTMTNVLIGLGWDARSTDGQDFDLDASAFLLTANGKVRNDADFIFYNNLKSSDGSVMHTGD
NRTGEGEGDDESLKIKLPLIPADVDKIVFVVTIHDAQARRQSFGQVANAFIRLVNDDNGVEIARYDLSEDASTETAMLFG
ELYRHNAEWKFRAVGQGYAGGLSSVCAQYGINAS

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
terD NP_286710.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 8e-78 87
terD_2 NP_287118.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 8e-78 87
tlrC AAF36435.1 putative tellurium resistance protein C Not tested TAI Protein 2e-77 86
unnamed ACY75542.1 tellurium-resistance protein Not tested Tn6060 Protein 5e-68 72
terE_2 NP_287119.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 5e-60 68
tlrB AAF36434.1 putative tellurium resistance protein B Not tested TAI Protein 3e-60 68
terE NP_286711.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 5e-60 68
unnamed ACY75541.1 tellurium-resistance protein Not tested Tn6060 Protein 5e-59 67
terZ NP_286706.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 7e-26 42
terZ_2 NP_287114.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 7e-26 42

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
terD NP_667896.1 tellurium resistance protein BAC0389 Protein 2e-77 87
terD NP_667896.1 tellurium resistance protein BAC0390 Protein 4e-64 69