Gene Information

Name : tlr0589 (tlr0589)
Accession : NP_681379.1
Strain : Thermosynechococcus elongatus BP-1
Genome accession: NC_004113
Putative virulence/resistance : Virulence
Product : two-component response regulator
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG0745
EC number : -
Position : 596142 - 596912 bp
Length : 771 bp
Strand : +
Note : -

DNA sequence :
ATGCTCTCTACTGAGACCGTTGCCGAACCCCCGGAGACTGCTGGTGTCCTACCAGCCGCAGTTGCCAACATTTTAGTGAT
TGAAGATGAAGATCTGATTCGGGAAACCGTTGTTCTGGCTTTGCAGGAGGAAGGCTACCATACCCTTGTGGCCAGCGATG
GCTATGAAGCCCTCAATCTCATTCATACCTATCTGTTGAGGGAGACTTCTCCTGAACAGGGAGAGGTGTGTTTGATCATC
CTAGATGTCATGCTACCGGGCATCAATGGCTTGGATCTGTGCCGACTAATTCGCCGTCAAGGCTGCACAGTTCCCATCCT
CATGATCAGCGCCAAAGGCAGTGAAATTGATCGAGTGGTTGGCCTTGAAATTGGTGCCGATGACTACTTGGCTAAGCCCT
TTGGCATGCGGGAGATGCTGGCCCGCTGCCGCGCCCTCTTGCGGCGGACACGAATTCAACAGGCTACCCTACCACCGGTT
CTGCGCTTTCGCGATCTGTGTCTTTATCCCCAAGAATGCCGCGCCACCCTGCGGGGCGAGGAGCTCAATCTCTCCCCCAA
AGAATACAAACTGCTCGAGCTGTTTATGCGTCACCCCCGCCGTGTGTGGCCACGGGAGCAGTTATTGGATCAGGTGTGGG
GTCCTGACTTTGTTGGCGACAGCAAAACGGTTGATGTCCACATCCGCTGGCTGCGGGAGAAAATTGAAACCGACCCCAGT
CATCCCCAGTACATTCTTACGGTGCGGGGTTTTGGCTATCGCTTTGGTTGA

Protein sequence :
MLSTETVAEPPETAGVLPAAVANILVIEDEDLIRETVVLALQEEGYHTLVASDGYEALNLIHTYLLRETSPEQGEVCLII
LDVMLPGINGLDLCRLIRRQGCTVPILMISAKGSEIDRVVGLEIGADDYLAKPFGMREMLARCRALLRRTRIQQATLPPV
LRFRDLCLYPQECRATLRGEELNLSPKEYKLLELFMRHPRRVWPREQLLDQVWGPDFVGDSKTVDVHIRWLREKIETDPS
HPQYILTVRGFGYRFG

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
c3565 NP_755440.1 response regulator Not tested PAI I CFT073 Protein 2e-30 41
unnamed CAD42044.1 hypothetical protein Not tested PAI II 536 Protein 8e-31 41

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
tlr0589 NP_681379.1 two-component response regulator BAC0197 Protein 9e-22 46
tlr0589 NP_681379.1 two-component response regulator HE999704.1.gene1528. Protein 2e-28 43
tlr0589 NP_681379.1 two-component response regulator NC_012469.1.7685629. Protein 9e-37 43
tlr0589 NP_681379.1 two-component response regulator AE000516.2.gene3505. Protein 9e-36 43
tlr0589 NP_681379.1 two-component response regulator NC_002745.1124361.p0 Protein 1e-32 42
tlr0589 NP_681379.1 two-component response regulator NC_009782.5559369.p0 Protein 1e-32 42
tlr0589 NP_681379.1 two-component response regulator NC_002951.3237708.p0 Protein 1e-32 42
tlr0589 NP_681379.1 two-component response regulator NC_007793.3914279.p0 Protein 1e-32 42
tlr0589 NP_681379.1 two-component response regulator NC_002758.1121668.p0 Protein 1e-32 42
tlr0589 NP_681379.1 two-component response regulator NC_009641.5332272.p0 Protein 1e-32 42
tlr0589 NP_681379.1 two-component response regulator NC_013450.8614421.p0 Protein 1e-32 42
tlr0589 NP_681379.1 two-component response regulator NC_002952.2859905.p0 Protein 1e-32 41
tlr0589 NP_681379.1 two-component response regulator NC_003923.1003749.p0 Protein 1e-32 41
tlr0589 NP_681379.1 two-component response regulator NC_007622.3794472.p0 Protein 1e-32 41
tlr0589 NP_681379.1 two-component response regulator AE016830.1.gene1681. Protein 3e-40 41
tlr0589 NP_681379.1 two-component response regulator NC_012469.1.7686381. Protein 1e-34 41
tlr0589 NP_681379.1 two-component response regulator NC_010410.6002989.p0 Protein 6e-21 41
tlr0589 NP_681379.1 two-component response regulator NC_010400.5986590.p0 Protein 5e-21 41
tlr0589 NP_681379.1 two-component response regulator NC_011595.7057856.p0 Protein 6e-21 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
tlr0589 NP_681379.1 two-component response regulator VFG1390 Protein 3e-32 42
tlr0589 NP_681379.1 two-component response regulator VFG1702 Protein 8e-31 41
tlr0589 NP_681379.1 two-component response regulator VFG1563 Protein 5e-31 41