Gene Information

Name : OB0594 (OB0594)
Accession : NP_691515.1
Strain : Oceanobacillus iheyensis HTE831
Genome accession: NC_004193
Putative virulence/resistance : Virulence
Product : two-component response regulator
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG0745
EC number : -
Position : 621066 - 621755 bp
Length : 690 bp
Strand : +
Note : CDS_ID OB0594

DNA sequence :
ATGGCAGAACGTATATTAATTGTGGAAGATGAACAAAAAATTAGCAGAGTATTACAGTTAGAGCTTGAATACGAAGGTTA
TGAATCTGAAGTAGCTAGTAATGGAAAAGATGCATTAAATAAAATTGAACAAGAAAACTGGGATCTTGTACTACTAGATA
TTATGATTCCTCAGCTAAGTGGATTAGAAGTGTTAAGACGTGTTCGGAGAGCAGAAAATCAAACGCCGATCATCTTATTA
ACTGCTCGTGATGAGGTTCATGATAAAGTAAGTGGTCTCGATTTAGGTGCGAATGATTACATAACGAAACCATTTCAAAT
AGAAGAGTTACTCGCTCGTGTACGTGTGCATTTACGAAAAGTTGTGCAGGCAGCGAATGATAACCAGACTTTATCAGTAG
CAGATCTACAGGTGGATTTACATGCGTATGAGGTCACGCGTAACGGTGAAAAAATTGAATTAACACCTCGCGAATTTAAT
TTATTGGTGTGTTTACTAAAGAATAAAAATATTGTTCTTACTCGAGAACAGTTAATTGAATCGGTATGGGGATACGATTA
TTTTGGAGATACAAATGTGGTAGATGTTTATATTCGTTATTTACGCCAGAAAGTAGATAAAAACTTTGAGATACCGATAA
TTCAAACTGTACGTGGTGTAGGTTATACAATTAAGGAAGATAAACAATGA

Protein sequence :
MAERILIVEDEQKISRVLQLELEYEGYESEVASNGKDALNKIEQENWDLVLLDIMIPQLSGLEVLRRVRRAENQTPIILL
TARDEVHDKVSGLDLGANDYITKPFQIEELLARVRVHLRKVVQAANDNQTLSVADLQVDLHAYEVTRNGEKIELTPREFN
LLVCLLKNKNIVLTREQLIESVWGYDYFGDTNVVDVYIRYLRQKVDKNFEIPIIQTVRGVGYTIKEDKQ

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
copR NP_460069.2 transcriptional regulatory protein YedW Not tested SPI-5 Protein 2e-37 44
copR AAC33719.1 regulatory protein CopR Not tested SPI-5 Protein 5e-37 44

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
OB0594 NP_691515.1 two-component response regulator HE999704.1.gene1528. Protein 1e-46 54
OB0594 NP_691515.1 two-component response regulator NC_007793.3914065.p0 Protein 2e-46 49
OB0594 NP_691515.1 two-component response regulator NC_002758.1121390.p0 Protein 2e-46 49
OB0594 NP_691515.1 two-component response regulator NC_010079.5776364.p0 Protein 2e-46 49
OB0594 NP_691515.1 two-component response regulator NC_002952.2859858.p0 Protein 2e-46 49
OB0594 NP_691515.1 two-component response regulator NC_007622.3794948.p0 Protein 2e-46 49
OB0594 NP_691515.1 two-component response regulator NC_003923.1003417.p0 Protein 2e-46 49
OB0594 NP_691515.1 two-component response regulator NC_013450.8614146.p0 Protein 2e-46 49
OB0594 NP_691515.1 two-component response regulator NC_002951.3238224.p0 Protein 2e-46 49
OB0594 NP_691515.1 two-component response regulator AE015929.1.gene1106. Protein 4e-42 49
OB0594 NP_691515.1 two-component response regulator BAC0308 Protein 3e-42 45
OB0594 NP_691515.1 two-component response regulator BAC0197 Protein 2e-40 45
OB0594 NP_691515.1 two-component response regulator BAC0638 Protein 6e-40 45
OB0594 NP_691515.1 two-component response regulator NC_012469.1.7685629. Protein 1e-43 44
OB0594 NP_691515.1 two-component response regulator AE000516.2.gene3505. Protein 4e-39 44
OB0594 NP_691515.1 two-component response regulator BAC0083 Protein 4e-43 43
OB0594 NP_691515.1 two-component response regulator NC_012469.1.7686381. Protein 2e-42 43
OB0594 NP_691515.1 two-component response regulator BAC0111 Protein 2e-40 43
OB0594 NP_691515.1 two-component response regulator BAC0125 Protein 3e-42 42
OB0594 NP_691515.1 two-component response regulator BAC0347 Protein 1e-36 42
OB0594 NP_691515.1 two-component response regulator NC_002952.2859905.p0 Protein 5e-44 41
OB0594 NP_691515.1 two-component response regulator NC_002745.1124361.p0 Protein 6e-44 41
OB0594 NP_691515.1 two-component response regulator NC_009782.5559369.p0 Protein 6e-44 41
OB0594 NP_691515.1 two-component response regulator NC_002951.3237708.p0 Protein 6e-44 41
OB0594 NP_691515.1 two-component response regulator NC_003923.1003749.p0 Protein 6e-44 41
OB0594 NP_691515.1 two-component response regulator NC_002758.1121668.p0 Protein 6e-44 41
OB0594 NP_691515.1 two-component response regulator NC_007622.3794472.p0 Protein 5e-44 41
OB0594 NP_691515.1 two-component response regulator NC_009641.5332272.p0 Protein 6e-44 41
OB0594 NP_691515.1 two-component response regulator NC_013450.8614421.p0 Protein 6e-44 41
OB0594 NP_691515.1 two-component response regulator NC_007793.3914279.p0 Protein 6e-44 41
OB0594 NP_691515.1 two-component response regulator FJ349556.1.orf0.gene Protein 3e-33 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
OB0594 NP_691515.1 two-component response regulator VFG0596 Protein 6e-38 44
OB0594 NP_691515.1 two-component response regulator VFG1390 Protein 5e-46 44
OB0594 NP_691515.1 two-component response regulator VFG1389 Protein 4e-41 42
OB0594 NP_691515.1 two-component response regulator VFG1386 Protein 1e-46 41