Gene Information

Name : c3616 (c3616)
Accession : NP_755491.1
Strain : Escherichia coli CFT073
Genome accession: NC_004431
Putative virulence/resistance : Unknown
Product : hypothetical protein
Function : -
COG functional category : L : Replication, recombination and repair
COG ID : COG3436
EC number : -
Position : 3454615 - 3454965 bp
Length : 351 bp
Strand : -
Note : Escherichia coli O157:H7 ortholog: z1599

DNA sequence :
ATGATTTCACTCCCATCAGGTACCCGTATCTGGCTCGTTGCCGGCGTTACTGATATGCGTAAATCCTTCAACGGTCTGGG
GGAGCAGATACAGCATGTGCTGGATGATAACCCCTTCTCCGGTCACCTGTTTATCTTCCGTGGCCGACGGGGAGACACGA
TTAAAATCCTGTGGGCTGATGCTGATGGTCTGTGCCTGTTCACCAAACGCCTTGAGGAAGGTCAGTTTATCTGGCCTGCG
GTGCGTGACGGTAAGATATCCATTACCCGCTCGCAACTGGCAATGCTCCTCGATAAGCTGGACTGGCGTCAGCCAAAAAC
ATCCCGCCTTAACGCACTGACAATGTTGTAA

Protein sequence :
MISLPSGTRIWLVAGVTDMRKSFNGLGEQIQHVLDDNPFSGHLFIFRGRRGDTIKILWADADGLCLFTKRLEEGQFIWPA
VRDGKISITRSQLAMLLDKLDWRQPKTSRLNALTML

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
ECUMN_3364 YP_002414037.1 putative transposase ORF2, IS66 family Not tested Not named Protein 5e-50 100
Z1160 NP_286695.1 hypothetical protein Not tested TAI Protein 7e-50 98
Z1599 NP_287103.1 hypothetical protein Not tested TAI Protein 7e-50 98
ECO103_3567 YP_003223430.1 hypothetical protein Not tested LEE Protein 1e-48 96
Z4338 NP_289563.1 hypothetical protein Not tested OI-122 Protein 1e-48 96
aec52 AAW51735.1 Aec52 Not tested AGI-3 Protein 1e-38 69
unnamed ADD91739.1 hypothetical protein Not tested PAI-I AL862 Protein 1e-38 69
pB171ORF50 CAD66190.1 ORF50 protein of pB171 Not tested PAI III 536 Protein 3e-38 68
unnamed AAL08461.1 unknown Not tested SRL Protein 2e-35 65
unnamed AAL99258.1 unknown Not tested LEE Protein 3e-35 64
unnamed ACU09438.1 IS66 family element orf2 Not tested LEE Protein 3e-35 64
c3561 NP_755436.1 hypothetical protein Not tested PAI I CFT073 Protein 6e-35 64
ECUMN_3327 YP_002414007.1 putative transposase ORF2, IS66 family Not tested Not named Protein 6e-35 64
c3578 NP_755453.1 hypothetical protein Not tested PAI I CFT073 Protein 5e-35 64
Z4336 NP_289561.1 hypothetical protein Not tested OI-122 Protein 5e-35 64
Z5097 NP_290248.1 prophage-associated protein Not tested LEE Protein 5e-35 64
unnamed AAC31493.1 L0014 Not tested LEE Protein 3e-35 64
ECs4546 NP_312573.1 hypothetical protein Not tested LEE Protein 5e-35 64
hp4 AAC61716.1 Hp4 Not tested PAI I CFT073 Protein 3e-35 64
Z1132 NP_286667.1 hypothetical protein Not tested TAI Protein 3e-34 63
Z1571 NP_287075.1 hypothetical protein Not tested TAI Protein 3e-34 63
l0014 CAD33776.1 L0014 protein Not tested PAI I 536 Protein 1e-26 63
ECO103_3553 YP_003223420.1 hypothetical protein Not tested LEE Protein 8e-35 61
Z4316 NP_289542.1 hypothetical protein Not tested OI-122 Protein 8e-35 61
BCAM0247 YP_002232879.1 putative transposase Not tested BcenGI11 Protein 5e-28 57

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
c3616 NP_755491.1 hypothetical protein VFG1737 Protein 1e-50 100
c3616 NP_755491.1 hypothetical protein VFG1665 Protein 1e-38 68
c3616 NP_755491.1 hypothetical protein VFG1052 Protein 1e-35 65
c3616 NP_755491.1 hypothetical protein VFG0792 Protein 1e-35 64
c3616 NP_755491.1 hypothetical protein VFG1698 Protein 2e-35 64
c3616 NP_755491.1 hypothetical protein VFG1709 Protein 1e-35 64
c3616 NP_755491.1 hypothetical protein VFG1517 Protein 5e-27 63