Gene Information

Name : c3641 (c3641)
Accession : NP_755516.1
Strain : Escherichia coli CFT073
Genome accession: NC_004431
Putative virulence/resistance : Unknown
Product : hypothetical protein
Function : -
COG functional category : L : Replication, recombination and repair
COG ID : COG3436
EC number : -
Position : 3480612 - 3480962 bp
Length : 351 bp
Strand : +
Note : Escherichia coli O157:H7 ortholog: z1599

DNA sequence :
ATGATCTCGCTCCCATCAGACACTCGAATCTCGCTGGTTGCCGGCGTTACTGATATGCGTAAATCCTTCAACGGTCTGGG
TGAACAGGTACAACATGTGCTGGATGAGAACCCCTTCTCCGGTCACCTGTTCATCTTCCGTGGCCGACGGAGTGACATGA
TTAAAATCCTCTGGGCTGATGCTGATGGTCTGTGCCTGTTCACCAAACGCCTGGAGGAAGGCCTGTTTATCTGGCCTGCG
GTGCGTGACGGTAAGGTATCCATTACCCGCTCGCAGCTGGCAATGCTCCTCGATAAGCTGGACTGGCGTCAGCCAAAAAC
ATCCCGTCTTAACGCACTGACAATGTTGTAA

Protein sequence :
MISLPSDTRISLVAGVTDMRKSFNGLGEQVQHVLDENPFSGHLFIFRGRRSDMIKILWADADGLCLFTKRLEEGLFIWPA
VRDGKVSITRSQLAMLLDKLDWRQPKTSRLNALTML

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
Z1160 NP_286695.1 hypothetical protein Not tested TAI Protein 2e-47 96
Z1599 NP_287103.1 hypothetical protein Not tested TAI Protein 2e-47 96
ECUMN_3364 YP_002414037.1 putative transposase ORF2, IS66 family Not tested Not named Protein 4e-47 94
ECO103_3567 YP_003223430.1 hypothetical protein Not tested LEE Protein 4e-46 93
Z4338 NP_289563.1 hypothetical protein Not tested OI-122 Protein 4e-46 93
aec52 AAW51735.1 Aec52 Not tested AGI-3 Protein 2e-36 67
unnamed ADD91739.1 hypothetical protein Not tested PAI-I AL862 Protein 2e-36 67
pB171ORF50 CAD66190.1 ORF50 protein of pB171 Not tested PAI III 536 Protein 5e-36 66
c3578 NP_755453.1 hypothetical protein Not tested PAI I CFT073 Protein 1e-32 63
unnamed AAL08461.1 unknown Not tested SRL Protein 6e-33 63
Z4336 NP_289561.1 hypothetical protein Not tested OI-122 Protein 1e-32 63
Z5097 NP_290248.1 prophage-associated protein Not tested LEE Protein 1e-32 63
ECs4546 NP_312573.1 hypothetical protein Not tested LEE Protein 1e-32 63
unnamed AAC31493.1 L0014 Not tested LEE Protein 8e-33 63
hp4 AAC61716.1 Hp4 Not tested PAI I CFT073 Protein 8e-33 63
c3561 NP_755436.1 hypothetical protein Not tested PAI I CFT073 Protein 2e-32 63
unnamed AAL99258.1 unknown Not tested LEE Protein 8e-33 63
ECUMN_3327 YP_002414007.1 putative transposase ORF2, IS66 family Not tested Not named Protein 2e-32 63
unnamed ACU09438.1 IS66 family element orf2 Not tested LEE Protein 8e-33 63
Z1132 NP_286667.1 hypothetical protein Not tested TAI Protein 7e-32 62
Z1571 NP_287075.1 hypothetical protein Not tested TAI Protein 7e-32 62
l0014 CAD33776.1 L0014 protein Not tested PAI I 536 Protein 4e-24 61
ECO103_3553 YP_003223420.1 hypothetical protein Not tested LEE Protein 3e-33 60
Z4316 NP_289542.1 hypothetical protein Not tested OI-122 Protein 3e-33 60
BCAM0247 YP_002232879.1 putative transposase Not tested BcenGI11 Protein 8e-27 57

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
c3641 NP_755516.1 hypothetical protein VFG1737 Protein 1e-47 94
c3641 NP_755516.1 hypothetical protein VFG1665 Protein 2e-36 66
c3641 NP_755516.1 hypothetical protein VFG1052 Protein 2e-33 63
c3641 NP_755516.1 hypothetical protein VFG1698 Protein 5e-33 63
c3641 NP_755516.1 hypothetical protein VFG1709 Protein 3e-33 63
c3641 NP_755516.1 hypothetical protein VFG0792 Protein 3e-33 63
c3641 NP_755516.1 hypothetical protein VFG1517 Protein 2e-24 61