Gene Information

Name : c4575 (c4575)
Accession : NP_756435.1
Strain : Escherichia coli CFT073
Genome accession: NC_004431
Putative virulence/resistance : Virulence
Product : hypothetical protein
Function : -
COG functional category : -
COG ID : -
EC number : -
Position : 4339544 - 4339969 bp
Length : 426 bp
Strand : +
Note : Escherichia coli K-12 ortholog: b2004; Escherichia coli O157:H7 ortholog: z1658

DNA sequence :
ATGAGCCGAATTATCGCCACCATCGAACTATTCTTAACTGATTTCAGTGAGGACTTTATCGTGTCAGACACACTGCCCGG
GACAACGCATCCCGACAACAACAACCGCCCCTGGTGGGGGCTACCCTGCACCGTGATGCCCTGTTTCGGGGCACGTCTGG
TGCAGGAGGGTAACCGCTTGCATTACCTTGCAGACCGCGCCGGTATCAGAGGCCGGTTCAGCGACGCGGATTCGTACCAC
CTGGACCAGGCCTTTCCGCTGCTGATGAAACAACTGGAGCTCATGCTCACCAGTGGTGAACTCAGCCCTCGCTATCAGCA
TACCGTCACGCTGTATGCGAAAGGACTGACCTGCGAAGCCGACACCTTCGGCTCCTGTGGTTACGTTTATCTGGCTGTTT
ATCCGACGCCCGAAACAAAAACGTAA

Protein sequence :
MSRIIATIELFLTDFSEDFIVSDTLPGTTHPDNNNRPWWGLPCTVMPCFGARLVQEGNRLHYLADRAGIRGRFSDADSYH
LDQAFPLLMKQLELMLTSGELSPRYQHTVTLYAKGLTCEADTFGSCGYVYLAVYPTPETKT

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
yeeU CAD42100.1 hypothetical protein Not tested PAI II 536 Protein 2e-49 91
c5150 NP_756998.1 hypothetical protein Not tested PAI II CFT073 Protein 2e-57 91
aec75 AAW51758.1 Aec75 Not tested AGI-3 Protein 3e-49 90
yeeU CAE85203.1 YeeU protein Not tested PAI V 536 Protein 1e-56 90
yeeU YP_854324.1 hypothetical protein Not tested PAI I APEC-O1 Protein 1e-57 90
yeeU AAZ04460.1 conserved hypothetical protein Not tested PAI I APEC-O1 Protein 9e-58 90
unnamed CAI43903.1 hypothetical protein Not tested LEE Protein 3e-51 90
yeeU YP_853121.1 antitoxin of the YeeV-YeeU toxin-antitoxin system Virulence PAI IV APEC-O1 Protein 4e-47 88
yeeU ADD91700.1 YeeU Not tested PAI-I AL862 Protein 4e-48 88
Z1220 NP_286755.1 structural protein Not tested TAI Protein 3e-48 88
Z1658 NP_287161.1 structural protein Not tested TAI Protein 3e-48 88
unnamed AAL57576.1 unknown Not tested LEE Protein 6e-51 88
unnamed CAD66206.1 hypothetical protein Not tested PAI III 536 Protein 8e-46 87
yeeU NP_708772.1 structural protein Not tested SHI-1 Protein 3e-48 87
unnamed AAK00481.1 unknown Not tested SHI-1 Protein 5e-49 87
yeeU NP_838486.1 structural protein Not tested SHI-1 Protein 3e-48 87
unnamed AAL67343.1 intergenic-region protein Not tested PAI II CFT073 Protein 3e-48 87
unnamed AAL08477.1 unknown Not tested SRL Protein 2e-47 86
ECO103_3591 YP_003223448.1 hypothetical protein Not tested LEE Protein 9e-45 86

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
c4575 NP_756435.1 hypothetical protein VFG1619 Protein 7e-50 91
c4575 NP_756435.1 hypothetical protein VFG1681 Protein 3e-46 87
c4575 NP_756435.1 hypothetical protein VFG0662 Protein 7e-49 87
c4575 NP_756435.1 hypothetical protein VFG1068 Protein 6e-48 86