Gene Information

Name : SE1606 (SE1606)
Accession : NP_765161.1
Strain : Staphylococcus epidermidis ATCC 12228
Genome accession: NC_004461
Putative virulence/resistance : Resistance
Product : penicillinase repressor
Function : -
COG functional category : K : Transcription
COG ID : COG3682
EC number : -
Position : 1661974 - 1662354 bp
Length : 381 bp
Strand : -
Note : -

DNA sequence :
ATGGCCAATAAGCAAGTTGAAATATCTATGGCTGAATGGGATGTTATGAATATAATATGGAATAAAAAATCAGTATCAGC
TAATGAAATTGTAGTTGAGATTCAAAAAAATAAAGAAGTTAGCGATAAGACGATTAGAACATTAATTACAAGACTATATA
AAAAAGAGATTATAAAACGATATAAATATAATAATATTTATTTTTACTCATCAATTATTAAAGAAGATGATATTAAAATG
AAAACTGCTAAAACCTTTCTTAATAAATTGTATGGAGGGGATATGAAAAGTTTAGTGCTTAATTTTGCGAAAAATGAAGA
ATTAAATAACAAAGAAATTGAAGAATTGCGAGACATTTTAAATGATATTAGTAAAAAATAA

Protein sequence :
MANKQVEISMAEWDVMNIIWNKKSVSANEIVVEIQKNKEVSDKTIRTLITRLYKKEIIKRYKYNNIYFYSSIIKEDDIKM
KTAKTFLNKLYGGDMKSLVLNFAKNEELNNKEIEELRDILNDISKK

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
blaI YP_253677.1 beta-lactamase repressor Not tested ¥ÕSh1 Protein 5e-41 97
mecI YP_039517.1 methicillin resistance regulatory protein MecI Not tested Type-II SCCmec Protein 8e-21 63
mecI NP_370567.1 methicillin resistance regulatory protein Not tested Type-II SCCmec Protein 2e-20 62
mecI NP_373280.1 methicillin resistance regulatory protein Not tested Type-II SCCmec Protein 4e-21 62
mecI YP_190060.1 methicillin-resistance regulatory protein MecI Not tested Type-II SCCmec Protein 4e-21 62
mecI BAA82218.1 methicillin resistance protein MecI Not tested Type-II SCCmec Protein 3e-21 62
mecI YP_005754043.1 methicillin resistance regulatory protein MecI Not tested Type-XI SCCmec Protein 1e-20 55

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
SE1606 NP_765161.1 penicillinase repressor NC_002952.2858973.p0 Protein 2e-41 97
SE1606 NP_765161.1 penicillinase repressor NC_010066.5774788.p0 Protein 1e-41 97
SE1606 NP_765161.1 penicillinase repressor NC_005054.2598289.p0 Protein 2e-41 97
SE1606 NP_765161.1 penicillinase repressor NC_005011.2598314.p0 Protein 1e-41 97
SE1606 NP_765161.1 penicillinase repressor NC_005951.2853407.p0 Protein 1e-41 97
SE1606 NP_765161.1 penicillinase repressor NC_010419.6155809.p0 Protein 1e-41 96
SE1606 NP_765161.1 penicillinase repressor NC_003140.1122763.p0 Protein 1e-41 96
SE1606 NP_765161.1 penicillinase repressor NC_002952.2861158.p0 Protein 3e-21 63
SE1606 NP_765161.1 penicillinase repressor NC_002745.1122814.p0 Protein 1e-21 62
SE1606 NP_765161.1 penicillinase repressor NC_009782.5560220.p0 Protein 5e-21 62
SE1606 NP_765161.1 penicillinase repressor NC_002758.1120003.p0 Protein 5e-21 62
SE1606 NP_765161.1 penicillinase repressor FR823292.1.gene6.p01 Protein 3e-21 55