Gene Information

Name : SE0018 (SE0018)
Accession : NP_763573.1
Strain : Staphylococcus epidermidis ATCC 12228
Genome accession: NC_004461
Putative virulence/resistance : Virulence
Product : response regulator
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG0745
EC number : -
Position : 24901 - 25602 bp
Length : 702 bp
Strand : +
Note : -

DNA sequence :
ATGGCTAGAAAAGTTGTTGTAGTTGACGATGAAAAACCAATTGCTGATATTTTAGAATTTAATTTAAAAAAAGAAGGTTA
CGACGTATATTGCGCTTATGATGGTAATGACGCAGTAGATTTAATCTATGAAGAAGAACCAGATATCGTCTTACTTGATA
TCATGTTACCTGGTAGAGATGGTATGGAAGTATGTCGTGAAGTGCGTAAAAAGTATGAAATGCCAATTATCATGTTAACA
GCGAAAGATTCTGAAATTGATAAAGTATTAGGCCTTGAATTAGGTGCAGATGATTACGTAACTAAACCATTTAGTACTCG
TGAACTCATCGCACGTGTGAAAGCGAACTTACGCCGTCATTATTCACAACCAGCTCAAGAAGTAAGTGGTGCGACAAATG
AAATTACAATTAAAGATATTGTGATTTATCCAGATGCATATTCAATTAAAAAACGTGGAGAAGACATTGAATTAACGCAT
CGTGAATTCGAGCTATTCCATTATCTTTCTAAACATATGGGTCAAGTCATGACACGTGAACACTTACTACAAACAGTGTG
GGGTTACGATTATTTCGGTGATGTTCGTACTGTGGACGTAACAATTCGCCGTTTAAGAGAAAAAATTGAAGATGATCCAT
CTCATCCAGAATACATTGTGACACGTAGAGGCGTTGGATACTTCCTCCAACAACATGATTAG

Protein sequence :
MARKVVVVDDEKPIADILEFNLKKEGYDVYCAYDGNDAVDLIYEEEPDIVLLDIMLPGRDGMEVCREVRKKYEMPIIMLT
AKDSEIDKVLGLELGADDYVTKPFSTRELIARVKANLRRHYSQPAQEVSGATNEITIKDIVIYPDAYSIKKRGEDIELTH
REFELFHYLSKHMGQVMTREHLLQTVWGYDYFGDVRTVDVTIRRLREKIEDDPSHPEYIVTRRGVGYFLQQHD

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
c3565 NP_755440.1 response regulator Not tested PAI I CFT073 Protein 3e-37 42
copR NP_460069.2 transcriptional regulatory protein YedW Not tested SPI-5 Protein 6e-33 41
unnamed CAD42044.1 hypothetical protein Not tested PAI II 536 Protein 3e-37 41

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
SE0018 NP_763573.1 response regulator NC_012469.1.7685629. Protein 1e-70 63
SE0018 NP_763573.1 response regulator NC_002952.2859905.p0 Protein 3e-56 53
SE0018 NP_763573.1 response regulator NC_002951.3237708.p0 Protein 3e-56 53
SE0018 NP_763573.1 response regulator NC_003923.1003749.p0 Protein 3e-56 53
SE0018 NP_763573.1 response regulator NC_002758.1121668.p0 Protein 3e-56 53
SE0018 NP_763573.1 response regulator NC_007622.3794472.p0 Protein 2e-56 53
SE0018 NP_763573.1 response regulator NC_009641.5332272.p0 Protein 3e-56 53
SE0018 NP_763573.1 response regulator NC_013450.8614421.p0 Protein 3e-56 53
SE0018 NP_763573.1 response regulator NC_007793.3914279.p0 Protein 3e-56 53
SE0018 NP_763573.1 response regulator NC_002745.1124361.p0 Protein 3e-56 53
SE0018 NP_763573.1 response regulator NC_009782.5559369.p0 Protein 3e-56 53
SE0018 NP_763573.1 response regulator HE999704.1.gene2815. Protein 3e-51 49
SE0018 NP_763573.1 response regulator NC_012469.1.7686381. Protein 1e-46 48
SE0018 NP_763573.1 response regulator AE016830.1.gene1681. Protein 2e-48 46
SE0018 NP_763573.1 response regulator AE000516.2.gene3505. Protein 7e-42 46
SE0018 NP_763573.1 response regulator AM180355.1.gene1830. Protein 7e-45 45
SE0018 NP_763573.1 response regulator NC_014475.1.orf0.gen Protein 6e-42 44
SE0018 NP_763573.1 response regulator AF130997.1.orf0.gene Protein 8e-42 44
SE0018 NP_763573.1 response regulator NC_005054.2598277.p0 Protein 6e-42 44
SE0018 NP_763573.1 response regulator FJ349556.1.orf0.gene Protein 7e-41 44
SE0018 NP_763573.1 response regulator AF155139.2.orf0.gene Protein 3e-38 43
SE0018 NP_763573.1 response regulator DQ212986.1.gene4.p01 Protein 3e-41 42
SE0018 NP_763573.1 response regulator NC_010079.5776364.p0 Protein 4e-36 41
SE0018 NP_763573.1 response regulator NC_002952.2859858.p0 Protein 4e-36 41
SE0018 NP_763573.1 response regulator NC_007622.3794948.p0 Protein 4e-36 41
SE0018 NP_763573.1 response regulator NC_003923.1003417.p0 Protein 4e-36 41
SE0018 NP_763573.1 response regulator NC_013450.8614146.p0 Protein 4e-36 41
SE0018 NP_763573.1 response regulator NC_002951.3238224.p0 Protein 4e-36 41
SE0018 NP_763573.1 response regulator NC_007793.3914065.p0 Protein 4e-36 41
SE0018 NP_763573.1 response regulator NC_002758.1121390.p0 Protein 4e-36 41
SE0018 NP_763573.1 response regulator AE015929.1.gene1106. Protein 4e-31 41
SE0018 NP_763573.1 response regulator HE999704.1.gene1528. Protein 6e-35 41
SE0018 NP_763573.1 response regulator AF162694.1.orf4.gene Protein 5e-37 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
SE0018 NP_763573.1 response regulator VFG1702 Protein 1e-37 42
SE0018 NP_763573.1 response regulator VFG0596 Protein 2e-33 41
SE0018 NP_763573.1 response regulator VFG1563 Protein 2e-37 41