Gene Information

Name : hha (ECA1165)
Accession : YP_049271.1
Strain : Pectobacterium atrosepticum SCRI1043
Genome accession: NC_004547
Putative virulence/resistance : Virulence
Product : hemolysin expression-modulating protein
Function : -
COG functional category : -
COG ID : -
EC number : -
Position : 1321060 - 1321263 bp
Length : 204 bp
Strand : -
Note : with Hns involved in transcriptional regulation of hemolysin; non-specific DNA-binding protein which affects the production of multiple proteins

DNA sequence :

ATGAAAAAAATCGACTATTTGATGCGTTTGCGTAAATGCACAACCATTGACACACTCGAACGTGTTATTGAAAAAAACAA
GTATGAGCTCTCCAATGATGAACTGGAGATGTTCTTTTCAGCAGCCGATCATCGCCTGGCTGAACTGACAATGAACAAAC
TCTACGACAAAATCCCTACCGCAGTATGGCGCTACGTACGTTAA

Protein sequence :

MKKIDYLMRLRKCTTIDTLERVIEKNKYELSNDELEMFFSAADHRLAELTMNKLYDKIPTAVWRYVR

• Homologs from PAI DB

Gene	GenBank Accn	Product	Virulance or Resistance	PAI or REI	Alignment Type	E-val	Identity
unnamed	AAL08465.1	putative transcriptional regulator	Not tested	SRL	Protein	1e-09	53

• Homologs from VFDB (virulence genes)

Gene	GenBank Accn	Product	ID of source DB	Alignment Type	E-val	Identity
hha	YP_049271.1	hemolysin expression-modulating protein	VFG1056	Protein	5e-10	53