Name : ECA2853 (ECA2853) Accession : YP_050944.1 Strain : Pectobacterium atrosepticum SCRI1043 Genome accession: NC_004547 Putative virulence/resistance : Virulence Product : hypothetical protein Function : - COG functional category : - COG ID : - EC number : - Position : 3196485 - 3196805 bp Length : 321 bp Strand : - Note : Similar to Shigella flexneri 2a hypothetical 14.0 kDa protein SWALL:Q9AL42 (EMBL:AF200692) (125 aa) fasta scores: E(): 1.5e-21, 58.65% id in 104 aa, and to Escherichia coli hypothetical protein ykfi or b0245 SWALL:YKFI_ECOLI (SWALL:P77692) (113 aa) fasta DNA sequence : ATGCAAACATCACCAGCAATCCCTCGACGGGAGGATAACCCCTGTCCGTCACCCATAGCCGCTTGGCAGCAACTTATGAC CTACCTGCTGGAAAAGCACTACGGCCTGATGCTGAATGACACACCGTTCTGCGAGGAAAACGTGATTCAGGAACATATCG ATGCTGGCATCACGTTGGTCAATGCCGTGAATTTTCTGGTGGAAAAATACGAACTGGTGCGTATCGACCGCGACGGTTTT AACTGGCAGGAGCAATCACCGTTTCTCACTGCCGTTGATGTTCTCCGTGCTAGACGCGCAACAGGTTTACTTAAGGCATA A Protein sequence : MQTSPAIPRREDNPCPSPIAAWQQLMTYLLEKHYGLMLNDTPFCEENVIQEHIDAGITLVNAVNFLVEKYELVRIDRDGF NWQEQSPFLTAVDVLRARRATGLLKA |
Gene | GenBank Accn | Product | Virulance or Resistance | PAI or REI | Alignment Type | E-val | Identity |
unnamed | AAK00482.1 | unknown | Not tested | SHI-1 | Protein | 5e-28 | 59 |
yeeV | NP_838487.1 | hypothetical protein | Not tested | SHI-1 | Protein | 8e-28 | 59 |
yeeV | NP_708773.1 | hypothetical protein | Not tested | SHI-1 | Protein | 8e-28 | 59 |
Z5091 | NP_290242.1 | hypothetical protein | Not tested | LEE | Protein | 2e-26 | 58 |
ECs4539 | NP_312566.1 | hypothetical protein | Not tested | LEE | Protein | 2e-26 | 58 |
unnamed | AAC31486.1 | L0007 | Not tested | LEE | Protein | 1e-26 | 58 |
unnamed | ACU09433.1 | conserved hypothetical protein | Not tested | LEE | Protein | 1e-26 | 58 |
unnamed | AAL67342.1 | intergenic-region protein | Not tested | PAI II CFT073 | Protein | 3e-27 | 58 |
yeeV | CAE85204.1 | YeeV protein | Not tested | PAI V 536 | Protein | 3e-27 | 58 |
unnamed | AAL57575.1 | unknown | Not tested | LEE | Protein | 1e-27 | 58 |
ECO103_3592 | YP_003223449.1 | hypothetical protein | Not tested | LEE | Protein | 1e-27 | 58 |
yeeV | YP_854325.1 | hypothetical protein | Not tested | PAI I APEC-O1 | Protein | 9e-28 | 58 |
z5091 | CAD33789.1 | Z5091 protein | Not tested | PAI I 536 | Protein | 7e-27 | 57 |
unnamed | CAI43848.1 | hypothetical protein | Not tested | LEE | Protein | 6e-27 | 57 |
aec76 | AAW51759.1 | Aec76 | Not tested | AGI-3 | Protein | 6e-27 | 57 |
unnamed | CAD42101.1 | hypothetical protein | Not tested | PAI II 536 | Protein | 1e-26 | 57 |
unnamed | CAD66207.1 | hypothetical protein | Not tested | PAI III 536 | Protein | 6e-26 | 57 |
unnamed | AAL08478.1 | unknown | Not tested | SRL | Protein | 9e-26 | 56 |
yeeV | ADD91699.1 | YeeV | Not tested | PAI-I AL862 | Protein | 3e-26 | 56 |
unnamed | AAL67389.1 | L0007-like protein | Not tested | PAI II CFT073 | Protein | 2e-26 | 56 |
c5149 | NP_756997.1 | hypothetical protein | Not tested | PAI II CFT073 | Protein | 3e-26 | 56 |
Gene | GenBank Accn | Product | ID of source DB | Alignment Type | E-val | Identity |
ECA2853 | YP_050944.1 | hypothetical protein | VFG0663 | Protein | 2e-28 | 59 |
ECA2853 | YP_050944.1 | hypothetical protein | VFG0786 | Protein | 5e-27 | 58 |
ECA2853 | YP_050944.1 | hypothetical protein | VFG1530 | Protein | 3e-27 | 57 |
ECA2853 | YP_050944.1 | hypothetical protein | VFG1620 | Protein | 4e-27 | 57 |
ECA2853 | YP_050944.1 | hypothetical protein | VFG1682 | Protein | 3e-26 | 57 |
ECA2853 | YP_050944.1 | hypothetical protein | VFG1069 | Protein | 4e-26 | 56 |