Gene Information

Name : VP0361 (VP0361)
Accession : NP_796740.1
Strain :
Genome accession: NC_004603
Putative virulence/resistance : Virulence
Product : two component response regulator transcription regulator protein
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG0745
EC number : -
Position : 358648 - 359340 bp
Length : 693 bp
Strand : +
Note : similar to EMB:CAD17806.1 (AL646080) percent identity 58 in 230 aa

DNA sequence :
TTGAAAATATTGATCGTCGAAGATGAGCACAAAGCCGGAGAATATCTGCAAAAAGGTTTGATTGAATCTGGGTATGTGGT
GGATTTAGTGCATGATGGGGTCGATGGGCTTTATCACGCTACCAGTGAAGAATATGACTTAATCCTCCTCGACATTATGT
TGCCTAAACTCGATGGTTGGCAGGTGCTTAACACATTGCGCAGTAGTGGGATTCACACTCCAGTGATCATGCTGACAGCG
AAGGAGCAAGTGGAAGATCGCGTGCGCGGTTTTGAGCTGGGTGCCAATGACTATGTGGTAAAACCTTACGCGTTTGCAGA
GCTACTGGCGCGTGTTCAAAACGTATTTCGTCATCATATTGCCGCGCAAGTGGTCGCATCGCCGCAAACATTACGTGTGG
CAGATTTAGAACTTGATATGATCAAACGCGTTGCCACGCGCGCGGGGCAGTCGATGTCGCTTACCGCCAAAGAATATGCC
CTGCTTGAGTTGTTGATGCGCAAAACTGGCCAAGTACTTTCACGTACCACCATTGCGTCGTTAGTGTGGGATATGAACTT
TGACAGCGATACCAATGTGATTGATGTGGCGGTCAAACGTCTGCGTAGCAAAGTGGACAAACCGTTCGATAGACCACTGA
TTCACACTGTCAGAGGGATGGGCTACAAACTCGAAGAGAGTCGTGATGCCTAA

Protein sequence :
MKILIVEDEHKAGEYLQKGLIESGYVVDLVHDGVDGLYHATSEEYDLILLDIMLPKLDGWQVLNTLRSSGIHTPVIMLTA
KEQVEDRVRGFELGANDYVVKPYAFAELLARVQNVFRHHIAAQVVASPQTLRVADLELDMIKRVATRAGQSMSLTAKEYA
LLELLMRKTGQVLSRTTIASLVWDMNFDSDTNVIDVAVKRLRSKVDKPFDRPLIHTVRGMGYKLEESRDA

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
copR NP_460069.2 transcriptional regulatory protein YedW Not tested SPI-5 Protein 1e-51 55
copR AAC33719.1 regulatory protein CopR Not tested SPI-5 Protein 8e-51 53

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
VP0361 NP_796740.1 two component response regulator transcription regulator protein BAC0197 Protein 4e-58 60
VP0361 NP_796740.1 two component response regulator transcription regulator protein BAC0125 Protein 9e-59 57
VP0361 NP_796740.1 two component response regulator transcription regulator protein BAC0308 Protein 4e-58 57
VP0361 NP_796740.1 two component response regulator transcription regulator protein BAC0111 Protein 6e-56 57
VP0361 NP_796740.1 two component response regulator transcription regulator protein BAC0638 Protein 6e-52 57
VP0361 NP_796740.1 two component response regulator transcription regulator protein BAC0083 Protein 1e-59 56
VP0361 NP_796740.1 two component response regulator transcription regulator protein BAC0347 Protein 7e-51 52
VP0361 NP_796740.1 two component response regulator transcription regulator protein HE999704.1.gene1528. Protein 4e-27 42
VP0361 NP_796740.1 two component response regulator transcription regulator protein AE000516.2.gene3505. Protein 2e-23 42
VP0361 NP_796740.1 two component response regulator transcription regulator protein NC_002951.3238224.p0 Protein 5e-29 41
VP0361 NP_796740.1 two component response regulator transcription regulator protein NC_007793.3914065.p0 Protein 5e-29 41
VP0361 NP_796740.1 two component response regulator transcription regulator protein NC_002758.1121390.p0 Protein 5e-29 41
VP0361 NP_796740.1 two component response regulator transcription regulator protein NC_010079.5776364.p0 Protein 5e-29 41
VP0361 NP_796740.1 two component response regulator transcription regulator protein NC_002952.2859858.p0 Protein 5e-29 41
VP0361 NP_796740.1 two component response regulator transcription regulator protein NC_007622.3794948.p0 Protein 5e-29 41
VP0361 NP_796740.1 two component response regulator transcription regulator protein NC_003923.1003417.p0 Protein 5e-29 41
VP0361 NP_796740.1 two component response regulator transcription regulator protein NC_013450.8614146.p0 Protein 5e-29 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
VP0361 NP_796740.1 two component response regulator transcription regulator protein VFG0596 Protein 5e-52 55
VP0361 NP_796740.1 two component response regulator transcription regulator protein VFG1389 Protein 7e-31 43
VP0361 NP_796740.1 two component response regulator transcription regulator protein VFG1390 Protein 5e-34 41