
|
Name : t2651 (t2651) Accession : NP_806362.1 Strain : Salmonella enterica Ty2 Genome accession: NC_004631 Putative virulence/resistance : Virulence Product : hypothetical protein Function : - COG functional category : K : Transcription COG ID : COG3311 EC number : - Position : 2740629 - 2740847 bp Length : 219 bp Strand : + Note : similar to Bacteriophage P4 DNA-binding protein (CAA35903) DNA sequence : ATGCCGCTGCCGGACATCACGCAGGAGCGTTTTTTACGTCTGCCGGAAGTGATGCACCTGTGCGGCCTGTCACGCTCGAC CATCTACGAACTCATCCGTAAGGGGGAATTTCCGCCGCAGGTGAGTCTTGGCGGTAAAAATGTGGCCTGGCTGCACTCTG AAATCACCGCATGGATGGCCGGACGCATTGCCGGACGCAAACGGGGGTACGACGCATGA Protein sequence : MPLPDITQERFLRLPEVMHLCGLSRSTIYELIRKGEFPPQVSLGGKNVAWLHSEITAWMAGRIAGRKRGYDA |
| Gene | GenBank Accn | Product | Virulance or Resistance | PAI or REI | Alignment Type | E-val | Identity |
| VC0497 | NP_230151.1 | transcriptional regulator | Not tested | VSP-2 | Protein | 1e-11 | 53 |
| VC0395_A1382 | YP_001217325.1 | transcriptional regulator | Not tested | VPI-2 | Protein | 6e-10 | 49 |
| VPI2_0033 | AAX20900.1 | transcriptional regulator | Not tested | VPI-2 | Protein | 4e-10 | 49 |
| VC1785 | NP_231420.1 | transcriptional regulator | Not tested | VPI-2 | Protein | 6e-10 | 49 |
| VC1809 | NP_231443.1 | transcriptional regulator | Not tested | VPI-2 | Protein | 6e-12 | 49 |
| VC0395_A1406 | YP_001217349.1 | transcriptional regulator | Not tested | VPI-2 | Protein | 6e-12 | 49 |
| VPI2_0041 | ACA01856.1 | predicted transcriptional regulator | Not tested | VPI-2 | Protein | 4e-12 | 49 |
| PMI2608 | YP_002152324.1 | prophage regulatory protein | Not tested | Not named | Protein | 2e-06 | 41 |
| unnamed | CAB46594.1 | DNA-binding protein | Not tested | HPI | Protein | 3e-08 | 41 |
| unnamed | CAA21398.1 | - | Not tested | HPI | Protein | 4e-08 | 41 |
| Gene | GenBank Accn | Product | ID of source DB | Alignment Type | E-val | Identity |
| t2651 | NP_806362.1 | hypothetical protein | VFG1118 | Protein | 2e-10 | 49 |
| t2651 | NP_806362.1 | hypothetical protein | VFG1141 | Protein | 2e-12 | 49 |